KEGG   Rickettsia amblyommatis Ac37: AL573_03315Help
Entry
AL573_03315       CDS       T04237                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
rab  Rickettsia amblyommatis Ac37
Pathway
rab00550  Peptidoglycan biosynthesis
rab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AL573_03315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rab01002]
    AL573_03315
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rab01011]
    AL573_03315
Enzymes [BR:rab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AL573_03315
Peptidases and inhibitors [BR:rab01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AL573_03315
Peptidoglycan biosynthesis and degradation proteins [BR:rab01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AL573_03315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase CytoC_RC
Motif
Other DBs
NCBI-ProteinID: ALA61731
LinkDB All DBs
Position
621146..622066
Genome map
AA seq 306 aa AA seqDB search
MFRKFLLPYIFVVTFFFAPISEATKAVKNTPKPPVQTSLVIDAKSGKVLQAHNSQIRIYP
ASLTKLMTLYLMFEAIEAGKLPLDKKLLVSAKASKMPPCKLGLKAGETITVREAINGLII
KSANDAAVTVAEGMKGSEKAFAHLMNVKAKQLGMKNTYFKNASGWHDPLQQTTARDMAKL
AMALKRDYPKFYPLFAKTSFVFRGNVVNGHNRVTKNYQGAEGMKTGFHTPAGYNLVTTAS
RNGKSLIAVVTGGKSAASRDQKMMGLLDQHFNIKPIVPKPSIKLASNSKSTTKAKSKIIK
KKNIRS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtttaggaaatttttattaccttatatttttgtcgtaacatttttctttgctcctata
agcgaagcaacaaaagccgtaaaaaatacccctaaacctcctgttcaaactagtttagta
attgatgcaaaaagcggtaaagtgttgcaggcccataattcacaaattcggatttacccc
gcttctttaactaagctaatgactctatacttaatgtttgaagcaattgaagccggtaag
ttacctttagataaaaaattacttgtatcagcaaaagcttcaaaaatgccgccttgtaag
ctgggtttaaaagcaggggaaactataaccgttcgagaggcaattaatggattaattata
aaatctgctaatgatgctgctgtaacggttgctgagggcatgaaaggttcagagaaagct
tttgctcatttaatgaatgttaaagctaaacagctcggtatgaagaacacctattttaaa
aatgcttcaggttggcatgacccattgcagcaaactaccgcaagagatatggctaaactt
gctatggctttgaagagagattatcctaaattttatccgttatttgctaaaaccagcttt
gtatttcgtggaaacgtagtaaacggacataatagggttactaaaaattatcaaggtgca
gaagggatgaaaacaggttttcatacaccggcaggttataatttagtaactactgcttct
aggaacggtaaatcattgattgccgttgttacaggcggcaaaagtgccgcatctcgtgat
caaaagatgatggggctactagatcagcattttaatattaagcctatagtccctaaacct
tcaatcaagcttgcctctaatagtaaatctactacaaaagctaaatcaaaaataataaag
aaaaagaatatacgtagttga

DBGET integrated database retrieval system