KEGG   Rhodoferax antarcticus: RA876_00710Help
Entry
RA876_00710       CDS       T04655                                 

Definition
(GenBank) HlyD family secretion protein
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
rac  Rhodoferax antarcticus
Brite
KEGG Orthology (KO) [BR:rac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rac02000]
    RA876_00710
Transporters [BR:rac02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   RA876_00710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 HlyD Biotin_lipoyl DUF4366 STAT_alpha
Motif
Other DBs
NCBI-ProteinID: APW45140
LinkDB All DBs
Position
152887..154140
Genome map
AA seq 417 aa AA seqDB search
MTDSPSDSPSTPSEPEASSANPKRKKGLTILAGVVAVAGLGWAAYAYFVARHFEDTDNAY
VQGDVIQITPQIGGTVLGILANDTDFVKAGQVLVQLDPADSAVALDQAQAALAQAVRLAR
TLYANNTTLTAQIALREADVTKARVDVERTSDDLKRRQSLSGNGAVSQEELKHAQQQFDS
AKSTLVAAQAGVLAAGEQLASNQTLTEGTRVEQQPSVQLAAARLREAFLATQRATLLAPV
DGYVAKRTVQLGQRVAAGTPLMSVIALSRVWVEANFKEVQLRNIRIGQPVTLVADQYGSK
VSYSGTVSGLGAGTGAAFSLLPAQNATGNWIKVVQRVPVRIALDATQLTEHPLRVGLSMT
AEVDVSKTDGLALADVPQVALAQPAVLPTDGAAEQLVQRVIAANLGQAAPGKPRGKL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacagcccttccgattccccaagcacgcccagtgaacctgaagcctctagcgcc
aaccccaaacgcaaaaaggggctgaccattctggctggggtggtcgccgtcgccggcctg
ggctgggccgcctacgcgtatttcgtggcccgccactttgaggacaccgacaacgcctat
gtgcaaggcgacgtgatccagatcaccccgcagatcggcggcacggtgctcggcatcctg
gccaacgacaccgacttcgtcaaagccgggcaagtgctggtgcagctcgacccggctgac
tcagcggtggcactggaccaggcccaggcggcgctggcgcaagcggtgcgcctggcgcgc
acgctgtatgccaacaacaccaccctgacggcacaaatcgccctgcgcgaagcggacgtg
accaaggcccgtgtcgacgtggagcgcaccagcgacgacctgaaacgccgccagtcgctg
agcggcaacggcgctgtgtcacaagaagaactgaaacacgcgcagcaacaatttgatagc
gccaaaagcacactggtcgccgcccaggccggtgttttggccgcaggtgaacagctcgcc
agcaaccagacgctgaccgaaggcacgcgggtagagcagcaacccagcgtgcaactggcc
gccgcccgtctgcgcgaagcctttttggccacgcagcgtgcgacgctgctggcgccggtg
gacggttatgtggccaaacgtaccgtgcagctcgggcagcgcgtggcggcgggcacaccg
ctgatgtcggtgattgcgttgagccgggtgtgggttgaggcgaacttcaaggaagtgcag
ctgcgcaacattcgcatcggccagccggtgacgctggtggccgatcaatacggctccaag
gtgagctacagcggcacggtgagtggtctgggtgcaggcactggtgcggcgttttcgctg
ctgcccgcgcaaaacgccacgggtaactggatcaaggtggtgcagcgggtgccggtgcgc
attgcgctggatgccacccaactgaccgagcacccactgcgcgtgggtttatcgatgacg
gccgaggtggatgtgagcaaaaccgatggtctggccctggcagatgtgccgcaggtggcg
ctggctcagcctgcagttttacccaccgatggcgcggcagagcagctggtgcagcgggtg
attgcggccaatctggggcaggcagcaccgggtaagccgcgcggcaagctgtaa

DBGET integrated database retrieval system