KEGG   Rhodoferax antarcticus: RA876_01140Help
Entry
RA876_01140       CDS       T04655                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rac  Rhodoferax antarcticus
Pathway
rac00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RA876_01140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rac02000]
    RA876_01140
Enzymes [BR:rac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RA876_01140
Transporters [BR:rac02000]
 Other Transporters
  Pores ion channels [TC:1]
   RA876_01140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-ProteinID: APW45211
LinkDB All DBs
Position
246852..247460
Genome map
AA seq 202 aa AA seqDB search
MKLYYSAGACSLSTHIALKESGLDFEAIAAPTKTHKLADGTDYYTINPLGYVPLLVLGDG
RQLHEVAVILQYVADQVPQLALAPANGTFERYKLQEWLNFIATELHKGFSPLFVPGMPDE
AKALAKARLLGRLLWVDGELAGHHFLMGDTFTVADAYLFVVQSWGKHVGVETTGLPNLSA
LAARVAARPAVQAALRAEGWVK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactttattattcggctggtgcctgctctctatctacccacatcgccctgaaagaa
tcaggactggactttgaggctatcgcagcgcccaccaaaactcacaagctcgccgacggc
actgactactacaccatcaacccgctcggctacgtgccgctgctggtactcggtgatggc
cggcagctacacgaggtcgccgtgatcctgcaatatgtggctgatcaggtgccacagctc
gcgctggccccggctaacggtacctttgagcgttacaaattgcaggaatggctcaacttt
atagccaccgaactgcacaagggcttctcacccctgttcgtgcccggtatgcccgatgag
gccaaggcactggccaaagcccgcctgttgggccgcctactttgggtcgacggtgagctc
gccggccatcacttcctgatgggcgacaccttcacagtggctgacgcctacctttttgta
gtgcaaagttggggcaagcatgtgggtgtggaaacgactggtctgcccaacctgagcgcc
ttggctgctcgcgttgcggcacgcccggcggtacaggcggcgttacgcgctgaaggttgg
gtcaaataa

DBGET integrated database retrieval system