KEGG   Rhodoferax antarcticus: RA876_14235Help
Entry
RA876_14235       CDS       T04655                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rac  Rhodoferax antarcticus
Brite
KEGG Orthology (KO) [BR:rac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RA876_14235
Enzymes [BR:rac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RA876_14235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like FAD_binding_3 DAO Glutaredoxin NAD_binding_8 Thi4 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: APW47322
LinkDB All DBs
Position
2952574..2954139
Genome map
AA seq 521 aa AA seqDB search
MLDQDLQTQLAAYLQRVILPFEIIASLSDSDSSNQLKQLLQQVDGMSDKISLRLDGDNDR
KPSFSLHRTGTATSLRFAAIALGHEFTSLVLALLWTGGHPPKVEPEVIEQIKSLDGDFNF
EVYMSLSCHSCPDVVQGLSLMAINNPKIKVTVIDGALFQDEVTQRQVMAVPSVFLNGELF
NSGRISVEEILAKLDTGSAARDAAKLNAQAPYDVLIVGGGPAGAAAAVYAARKGIRTGIA
AERFGGQVNDTMGIENFISVTETTGPKFAAAMQAHVKAYNVNIMNSQRADKLIPAAQAGG
LIEVQLANGGSLKSKTVILSTGARWRNVNVPGEQEYKNKGVAYCPHCDGPLYKGRRVGVI
GGGNSGVEAAIDLAGIVEHVTLIEFDTQLRADAVLVTKLQSLPNTTVIVNAQTTEITGDG
QKMNGLTFKDRASSEEHHLEMAGVFVQIGLVPNTEWLKGTLELSKHGEIVVDAKGATSLP
GVFAAGDATTVPFKQIIIAAGDGAKGALSAFDYLMRLPVAA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaccaagacctgcaaacccaactcgctgcctacctgcagcgcgttatccttccg
tttgaaatcatcgccagcctgagcgactcagacagctccaaccagctcaaacagctgctg
caacaagtcgacggcatgtctgacaagatcagtctgcgtctggacggcgacaacgatcgc
aagccctctttttcgctgcaccgcactggcactgccaccagcctgcgttttgccgctatt
gcgctgggccatgagttcacctcactggtgctggccctgttgtggaccggcggccacccg
cccaaggtcgaacccgaggtgattgaacaaattaagtcgctggatggcgacttcaatttc
gaggtctacatgtcgctgtcatgccatagctgccccgacgtggtacagggcttgagcctg
atggcgatcaacaacccgaagattaaggtcacggtgattgacggcgcgctgtttcaggat
gaagttacccagcgccaagtcatggcggtgccgtcggtttttttgaatggcgaactgttt
aattccgggcgcatcagcgtcgaagaaattctggccaagctcgacactggttctgcggca
cgtgatgcggccaagctcaacgcgcaagcaccctatgacgtattgatcgtcggcggtggc
cccgctggcgccgccgccgctgtgtacgccgcccgcaaaggcattcgcacaggcatcgcc
gccgagcgctttggcggacaggtgaatgacaccatgggcatcgagaacttcatctcggtg
accgagaccacgggtccaaaatttgccgccgcaatgcaagcgcatgtaaaggcctacaac
gtcaacatcatgaactcgcaacgcgctgacaaactcatcccagctgcgcaggcaggcggt
ttgatcgaagtgcagctggccaacggcggctcgctgaagagcaaaaccgtgattctgagc
accggcgcgcgctggcgcaatgtcaatgtacccggcgagcaggagtacaaaaacaaaggc
gtggcgtattgtccgcactgcgacggtccgctgtacaagggcaggcgcgtgggtgtgatc
ggtggcggcaactccggcgtggaagcagccattgacctagcgggtatcgtggagcatgtg
acgctgatcgagtttgacacccaactgcgcgccgacgcggtgctggtcaccaagctgcaa
agcctgcccaacaccaccgtcatcgtcaacgcccagaccactgagatcaccggcgacggc
cagaagatgaacggcctgactttcaaggaccgcgccagtagcgaagaacaccacctggag
atggccggtgtctttgtgcagattggcctggtgcccaacaccgagtggctcaagggcacg
ctggaactctccaaacacggcgaaatcgtagtggatgccaagggcgctacgtccctgccg
ggcgtgttcgctgcgggtgacgccaccaccgtgccgttcaaacagatcatcatcgccgca
ggcgacggtgccaagggcgcgttaagcgcgtttgactacctgatgcgcctgccggtggcg
gcctag

DBGET integrated database retrieval system