KEGG   Rhizobium acidisoli: CO657_13125
Entry
CO657_13125       CDS       T06438                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rad  Rhizobium acidisoli
Pathway
rad00473  D-Alanine metabolism
rad00550  Peptidoglycan biosynthesis
rad01100  Metabolic pathways
rad01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rad00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CO657_13125
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CO657_13125
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CO657_13125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rad01011]
    CO657_13125
Enzymes [BR:rad01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CO657_13125
Peptidoglycan biosynthesis and degradation proteins [BR:rad01011]
 Precursor biosynthesis
  Amino acid ligase
   CO657_13125
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 GARS_A ATP-grasp Arg_repressor
Other DBs
NCBI-ProteinID: QAS78948
LinkDB
Position
complement(2650796..2651722)
AA seq 308 aa
MSRKHVAVLMGGFSSERPVSLSSGKACAEALEAEGFDVTRIDVARDVSEKLAALKPDVVF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMDKDKAKLVAAAAGIPVAESQVINR
FAFPSTHPMKPPYVVKPVREGSSFGVVIVTEDQAHPPQIVSSSEWRYGEEVLVERYVYGR
ELTCGVMGETALGVTEVVPQGHNFYDYDSKYAAGGSKHVIPAKISPNIYQKIQRLALRAH
QAIGCRGVSRSDFRYDDRFTEDGEIIWLEVNTQPGMTPTSLVPEMAGHAGYSFGEFLRWM
VEDASCLR
NT seq 927 nt   +upstreamnt  +downstreamnt
atgagtcgcaagcatgtcgctgtcctgatgggcggattttcctcggaacggcctgtcagc
ctttcctcgggaaaggcttgcgcagaagccctcgaagcggaaggcttcgacgtgacgcgc
atcgatgtggcgcgcgatgtttcggaaaagcttgccgccttgaagcccgacgtggtcttc
aatgcgctgcacggccccttcggcgaggacggcaccattcagggcatcctcgaatatctc
gagatcccttatacgcattcgggcgtgcttgcctcggcgctggcaatggacaaggacaag
gcgaagcttgttgctgccgctgccggcattccggtcgccgaatcgcaggtcatcaaccgt
ttcgcctttccctcgacgcatccgatgaagccgccctatgtggtgaagccggtgcgggaa
gggtcgagcttcggcgtcgtcatcgttacggaagatcaggcgcatccgccgcaaatcgtc
agctcgtccgagtggcgctacggcgaggaagtgcttgtcgagcgctatgtctacggccgc
gaactcacctgcggcgtcatgggcgagactgcgctcggcgtcaccgaggtggtgccgcag
ggacacaatttttatgattacgattccaagtatgcagcgggcggttcaaaacacgtcatc
ccggcaaaaatttcaccgaatatttaccaaaaaatacaaagattggccctaagggcgcat
caggcaatcggttgtcgcggcgtcagtcggtccgactttcgttacgacgatcgtttcacc
gaagacggcgaaatcatctggctggaagtcaatacccagccaggcatgactccaacctcg
cttgtgcccgaaatggccggtcatgccggttattcctttggtgagtttctccggtggatg
gtggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system