KEGG   Riemerella anatipestifer RA-CH-2: G148_1208Help
Entry
G148_1208         CDS       T02438                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component-related enzyme
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rae  Riemerella anatipestifer RA-CH-2
Pathway
rae00020  Citrate cycle (TCA cycle)
rae00310  Lysine degradation
rae00380  Tryptophan metabolism
rae01100  Metabolic pathways
rae01110  Biosynthesis of secondary metabolites
rae01120  Microbial metabolism in diverse environments
rae01130  Biosynthesis of antibiotics
rae01200  Carbon metabolism
Module
rae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    G148_1208
  09105 Amino acid metabolism
   00310 Lysine degradation
    G148_1208
   00380 Tryptophan metabolism
    G148_1208
Enzymes [BR:rae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     G148_1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N HTH_22
Motif
Other DBs
NCBI-ProteinID: AGC40512
LinkDB All DBs
Position
1279887..1282595
Genome map
AA seq 902 aa AA seqDB search
MYQQYLKYPDSLEPSWKAFFQGFDFALENFGEDDSFTEKVGASSLSQQVGVPDDIIKEFK
VLNLIEAYRTRGHLFTRTNPVRERRTYLPDLSIENFGLSKSDLDTKFNSATETGMLGAAT
LADIIRHLDQIYCDSIGIEYMHIREVEEKEFIRQWISKNENHPELSADEKIQILSKLNQA
VAFENYLHTKFVGQKRFSLEGGESLIPALDQLISRSSKHGVDEVVLGMAHRGRLNVLTNI
FGKSYKQIFSEFEGKEFEEDVFSGDVKYHLGSTTKIKTAAGEEVIINLTPNPSHLETVAS
LVQGISRAKIDHTYGNNFKKVLPIVIHGDAAIAGQGIVYEIAQMMTLDGYKTGGTVHIVV
NNQVGFTTNYLDARSSTYCTDIAKVTDSPVMHVNADDVEAVVHAIRFAADYRAAFGKDVY
IDLLGYRKYGHNEGDEPRFTQPKLYNTIAKHPNPREIYKVKLEKEGVLSEGVLKKMEEEF
KTLLDKDFDASKEIQKNTLDVFMEQVWIKYLDPANKQKVLKAVETQYNAEQLKELAVKMS
SLPKDKAFIRKITRLFEQRLKMIEEDKLDWAMAELLAYATLLAEGYNVRISGEDVERGTF
SHRHAVVKTEDAEEEYVPLQHINESQQFHIYNSLLSEYAVLGFDYGYAMASPDTLTIWEA
QFGDFVNGAQIIVDQYLVAAEEKWKLQNGLVMLLPHGSEGQGAEHSSARLERFLTLCANN
NIFVANCTVPANYFHLLRRQMKFPFRKPLVVMTPKSLLRHPKVISSMEELANGSFQPVID
DATADASKVERLVMCSGKVYYDLLAKKEELGDEKVALVRLEQLYPLDSEKIETVLSKYSN
RKDFVWVQEEPENMGAWSYILRNFRKYDVQVIAPVPSGTPAPGSHKKYEINQTNVINQTF
GI
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagcagtacttaaaatacccagatagtttagagccatcttggaaagcttttttt
caagggtttgattttgctctagaaaattttggtgaagacgattcttttacagaaaaagta
ggtgcgtcttctttatctcagcaagtaggtgtcccagatgatattataaaggagtttaaa
gttcttaacttaatagaggcttatagaactagaggtcatttgtttactagaactaaccct
gttagagagagaagaacttatctccctgatttatctatagagaattttggattatcaaag
tcagatttagatactaaatttaactctgctacagaaacaggaatgctgggagctgctact
ttggcagacattattcgtcatttagaccaaatttattgcgactctatcggtatagaatat
atgcatattcgtgaggtggaggagaaggaatttattcgccagtggatttctaagaatgaa
aatcacccagaactttcggcagacgaaaaaatacagattttatctaagctcaatcaagcg
gtagcatttgaaaactatcttcatactaaattcgtaggacaaaagagattttcactggaa
ggaggagagtctttaatccctgctttagaccagcttattagtcgttcttcaaaacatggt
gtagatgaagtggttttgggtatggcacacagagggaggcttaatgtattaactaatatc
tttgggaaatcatacaagcaaatcttctctgaatttgaaggtaaagaatttgaggaagat
gtattttctggagatgttaagtatcacttaggttctactacgaaaataaaaacggctgca
ggagaagaggtaattatcaatttaacgcctaacccgtctcacttagaaactgtagcttct
ttagtacaaggtatttctagagctaaaatagaccatacttacggtaataattttaaaaaa
gtattaccgattgttatccatggagatgcagctattgcaggacaaggaattgtctacgag
attgcacaaatgatgactttagacggctacaagacaggaggaacggttcatattgtagtt
aataatcaggtaggatttacaaccaactatctagatgcgaggtcttctacttattgtacg
gatattgctaaggtaacagactcgcctgtgatgcatgtaaatgcagatgatgtagaggct
gtggtacatgcaattagatttgcggcagattatagagcagcgtttggcaaagatgtttat
atagatttgttaggatacagaaagtacggacataacgaaggtgatgagcctcgttttacg
cagcctaaactttataataccattgcgaaacaccctaatcctagagaaatatataaagta
aaactagagaaagaaggagtgctttctgaaggagtgttgaagaagatggaggaagaattt
aaaacccttcttgataaagattttgatgcatctaaagaaattcaaaaaaatactttagat
gtatttatggaacaggtttggattaagtatctagaccctgcaaataaacaaaaagttcta
aaggctgtagaaactcaatacaatgctgaacagttaaaagagttggcagttaagatgtct
tctttacctaaagacaaggcgttcataagaaaaatcactagactttttgaacaaaggcta
aaaatgatagaagaggataagttagattgggcaatggcagaacttttagcttatgctacg
cttcttgcagaagggtacaatgtgagaatttctggggaagatgtggagagaggtactttc
tctcaccgtcatgcagtggtaaaaacagaagatgcagaggaggaatatgtaccattacaa
catatcaacgaaagtcagcagtttcatatttataactcattactatcagagtacgctgtt
ttagggtttgattatggttatgctatggcatcgcctgatactttaaccatttgggaagca
cagtttggagatttcgtgaatggcgctcaaattattgtggaccaatatttggtagctgca
gaagaaaaatggaagctgcaaaatggtttggtaatgttgttacctcacggctctgaaggg
caaggtgcagaacactcttcggctaggttagagagatttttaacgctttgtgctaataat
aatattttcgtagctaactgtacagttccagccaattatttccatttattgagaaggcaa
atgaagtttccgtttagaaaaccgttagtggtaatgacacctaagtcgttactaagacac
cctaaggttatttcttctatggaagagttagcaaacggaagtttccaaccagtgattgat
gatgctacggctgatgcttctaaggtggagagattagtgatgtgttctggtaaggtttac
tacgatttattggctaaaaaagaggaattgggagatgagaaagtagctttagtaaggctg
gagcagttatatcctttggattcagagaaaatagagactgtgttgtctaaatattctaac
agaaaagattttgtatgggttcaagaagagccagagaatatgggagcttggtcttatatt
ttgagaaatttccgcaagtatgatgtacaagtaattgcaccagttcctagtggaacgcca
gcaccaggtagccataagaagtatgagattaaccaaactaatgtaattaaccaaacattt
ggtatctag

DBGET integrated database retrieval system