KEGG   Riemerella anatipestifer RA-CH-2: G148_1572Help
Entry
G148_1572         CDS       T02438                                 

Definition
(GenBank) hypothetical protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rae  Riemerella anatipestifer RA-CH-2
Pathway
rae00061  Fatty acid biosynthesis
rae00780  Biotin metabolism
rae01100  Metabolic pathways
rae01130  Biosynthesis of antibiotics
rae01212  Fatty acid metabolism
Module
rae_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    G148_1572
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    G148_1572
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    G148_1572
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rae01004]
    G148_1572
Enzymes [BR:rae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     G148_1572
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     G148_1572
Lipid biosynthesis proteins [BR:rae01004]
 Fatty acid synthase
  Component type
   G148_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short CactinC_cactus
Motif
Other DBs
NCBI-ProteinID: AGC40876
LinkDB All DBs
Position
complement(1670657..1671475)
Genome map
AA seq 272 aa AA seqDB search
MSYGLLKGKKGIIFGALNEQSIAWKVAERCHEEGAEFILSNAPIAMRMGELNALAEKTGA
EVIGADATSMEDLEKLFDAAIEKFGKLDFILHSIGMSVNVRKGKPYTDLNYSFLEKGWDV
SAVSFHKVMKTAWDKDCMNEWGSILALSYIAAQRTFPDYNDMADNKSYLESIARSFGYYW
GERKVRVNTISQSPTPTTAGSGVKGFGGFLGYAEDMSPLGNATALDCANYCVAMFSDLTR
KVTMQNLFNDGGFSNTGVSQKIVDRYDESKED
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcatacggattattaaaaggaaaaaagggaattatatttggagctcttaacgagcaa
tctatcgcttggaaagtagcagaaagatgtcatgaagaaggtgctgaatttatcttatct
aatgcacctatcgctatgagaatgggagaattaaacgctttggcagaaaaaacaggagcc
gaagtaataggggcagacgctacttctatggaagatttagaaaaactttttgatgctgcg
atagaaaaatttggaaagctagattttattttacactctataggaatgtcggttaatgta
agaaaaggaaaaccttatactgaccttaattatagctttttagaaaaaggttgggatgtg
tcggcggtttctttccataaagttatgaaaaccgcttgggataaagattgtatgaacgag
tggggctctattttagcactttcttacattgcagctcagagaactttcccagactataac
gatatggcagataacaaatcttatttggagagtattgcgagaagctttgggtactattgg
ggtgaaagaaaagtaagagtaaacaccatatcacaatctccaacacctacaacagcagga
agtggggtaaaaggctttggcggtttcttgggttatgcagaagatatgtctccactaggt
aacgcaacagctttagattgtgctaactactgcgtagctatgttttctgatttaacaaga
aaggtaacgatgcaaaatcttttcaacgatggaggatttagcaatactggggtttctcag
aagatagtggataggtatgacgaaagtaaagaagattaa

DBGET integrated database retrieval system