KEGG   Riemerella anatipestifer RA-CH-2: G148_2010Help
Entry
G148_2010         CDS       T02438                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rae  Riemerella anatipestifer RA-CH-2
Pathway
rae00473  D-Alanine metabolism
rae00550  Peptidoglycan biosynthesis
rae01100  Metabolic pathways
rae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    G148_2010
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    G148_2010
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    G148_2010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rae01011]
    G148_2010
Enzymes [BR:rae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     G148_2010
Peptidoglycan biosynthesis and degradation proteins [BR:rae01011]
 Precursor biosynthesis
  Amino acid ligase
   G148_2010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 ATP-grasp GARS_A RimK ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AGC41314
LinkDB All DBs
Position
complement(2119975..2120931)
Genome map
AA seq 318 aa AA seqDB search
MGGYSDEYKVSLKSGQLIYDSLDRDLYNVYKVVVLKEGWFYLDENEAKLPIQKGDFSVNL
PSGEVLRFDVCFNIIHGTPGENGVLQAYWDAIGQKYTGCDFYQSALTFNKKDTLAVLAKY
GIPSAKSFYIKKGEAYDKDKIINELKLPLFVKPNQSGSSLGISKVKEVSEFEAALEKAFL
EDDEVLVESFLDGMEVSVGVLDYKGETIVLGITEIIPETEFFDYEAKYQGASQEIIPARL
DEATRLRVEEVAKRAYNYLGMKGFSRSEYIIMDGVPYMLEMNTNPGFSPASILPQQARIY
GISITDLCGNEVEKALAK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgggcggatactctgatgagtacaaagtttccctaaaaagtggacaactaatttacgac
tctttagaccgtgatttatacaatgtttataaagtggtagttcttaaagaaggttggttt
tatttagatgaaaatgaagctaagctaccaatacaaaagggagatttctctgtaaatcta
cctagtggagaagtactgcgttttgatgtttgctttaatatcattcatgggacaccaggt
gaaaacggcgtgttacaagcatattgggacgctattggtcaaaaatatacagggtgcgat
ttttaccaaagtgcacttacctttaataaaaaggatactttggctgtattagcaaagtat
ggtattccgtctgctaaaagtttctacataaaaaaaggggaggcttatgataaagataaa
attatcaacgagttaaaactgcctctatttgtaaagcctaaccaaagtggttcttcttta
ggaatttctaaggtaaaagaggtttcggagtttgaagcggctttagaaaaagcatttttg
gaagacgatgaggttttagtagaaagtttcttagacggtatggaggtatctgtgggtgtg
ctagattacaaaggtgagactattgttttaggcattacagaaattatcccagaaacagaa
ttttttgattatgaagcaaagtatcaaggagcgtctcaagagattatccctgcaaggcta
gatgaggctactagattaagagtagaggaagttgcaaaaagagcttataactatttagga
atgaaagggttttctagaagtgaatatattattatggatggtgtgccttatatgctagaa
atgaatactaaccctggtttttcacctgcgagtatccttcctcaacaagcgagaatttac
ggtatctccattacagatttgtgtggaaacgaggtagaaaaagctctagcaaaataa

DBGET integrated database retrieval system