KEGG   Rickettsia africae: RAF_ORF0639Help
Entry
RAF_ORF0639       CDS       T00979                                 

Gene name
pdhC
Definition
(GenBank) Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
raf  Rickettsia africae
Pathway
raf00010  Glycolysis / Gluconeogenesis
raf00020  Citrate cycle (TCA cycle)
raf00620  Pyruvate metabolism
raf01100  Metabolic pathways
raf01110  Biosynthesis of secondary metabolites
raf01120  Microbial metabolism in diverse environments
raf01130  Biosynthesis of antibiotics
raf01200  Carbon metabolism
Module
raf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:raf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RAF_ORF0639 (pdhC)
   00020 Citrate cycle (TCA cycle)
    RAF_ORF0639 (pdhC)
   00620 Pyruvate metabolism
    RAF_ORF0639 (pdhC)
Enzymes [BR:raf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RAF_ORF0639 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ACP53539
UniProt: C3PNM9
LinkDB All DBs
Position
672472..673710
Genome map
AA seq 412 aa AA seqDB search
MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV
IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLPKPHENIANVEEQ
VTVIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILSYTPSTAHNKIVSR
NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKFFSEDKSTR
ISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVTPIVKNANQKN
ILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQSCIMGVGAS
AKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPVLMLI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgctttatctccaactatgacggaaggaaatctagct
aggtggttaaaaaaagaaggggacaaagttaatcctggagaagtaattgctgaaattgaa
accgataaagcaacgatggaagtagaagcagtagatgaaggtatacttgccaaaatagtt
atcccacaaaatagtcaaaatgtacctgttaactctttaattgccgtgttaagtgaagag
ggagaagaaaaaacagacattgatgcgtttattgcaaaaaataatagtgtatcaccgtca
ccgaaaacagatgctaatcttccgaaaccccacgagaatatagctaatgtagaagaacag
gtaacagttataaaacatgatgctagtaaaatattcgcctcaccgcttgcaaaaagactt
gcaaaaatgagaaatattagatttgagagcgtgaaaggtagcggtccgcacggtagaata
gtcaaacaagatatcttatcatatactcctagcactgctcataataaaatagttagcagg
aatcctgaagaatatcgtttagtaccaaataataatatccgcaagattatagccaagcgt
ctgcttgaatctaaacaaacagttccacatttttatttatctatagaatgtaatgtcgat
aaattgttagatataagagaagacattaataaatttttttctgaagataaatcaacaagg
atatcggttaatgattttattattttagcagtagccaaagctttacaagaagtgccaaat
gccaatgctagctggggagaagatgcaattagatattacaataatgtcgatatttcagta
gcggtagcgattgagaacgggcttgttacaccgatagttaaaaatgccaatcaaaaaaat
attctagaactatctcgtgaaatgaaagcattaataaagaaagcaaaagataataaatta
acccctgaagaatttcagggcggagggtttaccatttctaacctcggtatgtacggtatt
aagaatttcaatgctataattaacccaccacaaagttgtataatgggcgtcggagctagt
gcaaaacgtgctatagtcaagaatgatcaaataactatagcaacaattatggacgtaact
ctttctgccgatcaccgagtagtagacggagcagtcggtgctgagttcttggcagcattt
aaaaagtttatagagagtcccgttttgatgttgatataa

DBGET integrated database retrieval system