KEGG   Riemerella anatipestifer RA-CH-1: B739_0012Help
Entry
B739_0012         CDS       T02331                                 

Definition
(GenBank) hypothetical protein
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
rag  Riemerella anatipestifer RA-CH-1
Brite
Enzymes [BR:rag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     B739_0012
Prokaryotic defense system [BR:rag02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    B739_0012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII TelA DUF2135
Motif
Other DBs
NCBI-ProteinID: AFR34622
UniProt: J9R4E2
LinkDB All DBs
Position
complement(10142..10981)
Genome map
AA seq 279 aa AA seqDB search
MSEQFKIFLSQLSETNATLDYFADFKKIRNNVNKIAIKLNQLNYLIGKENLKEAVIELYE
ENSKVFEVLDILIAIRKNKNAKTFNNKGEIVLLDTYFTSPELILEYIEETGLAEVFRNKD
VTNLVDYVFGIEVGLDTNARKNRGGDNMSKAVSLIFDKAGVFYKKEVNNTIFPEIISLGA
DVKRFDFVIKTKKKTYLIETNYYNSGGSKLNETARSYSDVAPKINLYEGYEFVWITDGQG
WFSAKNKLEEAYNIIPSLYNLITLEDFIKKIQEETVIEF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcaatttaaaatctttttatcgcaactttcagaaactaacgcaacgcttgat
tatttcgcagattttaagaaaataaggaacaatgtaaacaaaattgcaatcaaacttaac
caattgaattatttaattggcaaagaaaatttgaaagaagcggtaatagaactttatgaa
gaaaattcaaaagtttttgaagtgttggacatcttgattgctattcgcaaaaacaaaaac
gctaaaacattcaacaacaaaggcgaaatagtattgttagacacttatttcacctcgcct
gaactgattttggaatatattgaagaaacgggattggcagaagtttttagaaacaaagat
gttactaatttagttgactatgtttttggaatagaggttggtttagatacaaatgcacga
aaaaacagagggggtgacaatatgtcaaaagctgtttcactcatttttgacaaagcagga
gttttctacaaaaaggaagtaaataatacaatctttccagaaatcataagtttaggtgca
gatgtgaaacgttttgattttgtcattaaaaccaaaaagaaaacttatttaattgaaact
aattattacaatagtggaggttcaaaattaaatgaaacagcaagatcttattctgatgtt
gctcctaaaattaacctatatgaaggttacgaatttgtttggataactgatggacaaggt
tggttttctgcaaaaaacaaattagaagaagcatataacataattccaagtttgtacaat
ttgataacacttgaggattttatcaagaaaattcaagaagaaactgtaatagaattttaa

DBGET integrated database retrieval system