KEGG   Riemerella anatipestifer RA-CH-1: B739_0293Help
Entry
B739_0293         CDS       T02331                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
rag00473  D-Alanine metabolism
rag00550  Peptidoglycan biosynthesis
rag01100  Metabolic pathways
rag01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B739_0293
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B739_0293
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    B739_0293
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rag01011]
    B739_0293
Enzymes [BR:rag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B739_0293
Peptidoglycan biosynthesis and degradation proteins [BR:rag01011]
 Precursor biosynthesis
  Amino acid ligase
   B739_0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 ATP-grasp GARS_A ATPgrasp_Ter RimK
Motif
Other DBs
NCBI-ProteinID: AFR34899
UniProt: J9QZP8
LinkDB All DBs
Position
complement(308748..309731)
Genome map
AA seq 327 aa AA seqDB search
MSKKNIAVVMGGYSDEYKVSLKSGQLIYDSLDRDLYNVYKVVVLKEGWFYLDENEAKLPI
QKGDFSVNLPSGEVLRFDVCFNTIHGTPGENGVLQAYWDAIGQKYTGCDFYQSALTFNKK
DTLAVLAKYGIPSAKSFYIKKGEAYDKDEIINELKLPLFVKPNQSGSSLGISKVKEASEF
EAALEKAFLEDDEVLVESFLDGMEVSVGVLDYKGETIVLGITEIIPETEFFDYEAKYQGA
SQEITPARLDEATKLRVEEVAKRAYNSLGMKGFSRSEYIIMGGVPYMLEMNTNPGFSPAS
ILPQQARIYGISIKDLCGNEVEKALAK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaaaatatagccgtagttatgggcggatactccgatgagtacaaagtttcc
ctaaaaagtggacaactaatttacgactctttagaccgtgatttatataatgtctataaa
gtggtagttcttaaggaaggttggttttatttagatgaaaatgaggctaaactaccaata
caaaagggagatttttctgtaaacttacctagcggggaagtgttacgctttgatgtttgt
tttaataccattcacgggacaccaggtgaaaatggtgtgttacaggcgtattgggacgct
attggtcaaaaatatacagggtgcgatttttaccaaagtgcacttacctttaataaaaaa
gatactttggctgtattagcaaagtatggtattccgtccgctaaaagtttctacataaaa
aaaggagaggcttatgataaagatgaaattatcaacgagttaaaactgcctctatttgta
aagcccaaccaaagtggttcttctttaggaatttctaaggtaaaagaggcttcggagttt
gaagctgctttagaaaaagcatttttggaagatgatgaggttttagtagaaagtttctta
gacggtatggaggtatctgtgggcgtgctagattacaaaggggagactattgttttaggc
attacagagattatcccagagacagaattttttgattacgaagcgaagtatcaaggagcg
tctcaagagattacccctgcaagactagatgaggctactaaactaagagtagaggaggtt
gcaaaaagagcttataactctttaggaatgaaaggattttctagaagtgaatatattatt
atgggcggtgtgccttatatgctagaaatgaataccaatccagggttttcacctgcgagt
atccttcctcaacaagcgagaatttacggtatctccattaaagatttgtgtggaaacgag
gtagaaaaagctctagcaaaataa

DBGET integrated database retrieval system