KEGG   Riemerella anatipestifer RA-CH-1: B739_0462Help
Entry
B739_0462         CDS       T02331                                 

Definition
(GenBank) hypothetical protein
Organism
rag  Riemerella anatipestifer RA-CH-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_1 DUF3256 AvrPphF-ORF-2 DUF562 Ig_3 LRR_6
Motif
Other DBs
NCBI-ProteinID: AFR35066
UniProt: J9QSU0
LinkDB All DBs
Position
492717..494390
Genome map
AA seq 557 aa AA seqDB search
MDSGTKNSYICQKIKLLKTFLYFLFFTFYSFLNAQGIIASEKEVLVQIYQQTDGKNWNRT
WDLSADPSEWFGVNTNNGSVTELRLNGNLLHGKLPSLTGLKNLKVLDLSSNHLSGDLPSI
NNLNQLELLDLSNNNFEGDVSNQFTNLTQLHTLSLGNNKLSLSTPDTFLNSFLNLKVLDL
SNFNLQEIPSRVSSLNFIQELNLSGNPIKSGFSHLSKLKSLKKLDLSSTQMEAIPAEVNS
LTQLISLNLSKNNLKENSINGIENLNLLEWLSLDQNHLNSIPPALGKLENLVYLNLSGNN
LKENFAIIKHLSSLQYLNLSHNQIEGNFPNELSQLEKLMFLSLSGNQLTGELPNPLPPIT
DISNNRFTSVHIKQYLIHSSQRVDFTYSPQRYDEPTAIKTKIGASVNLTQSLESSQGYSF
QWLKSLDTKTNVSSENLRLNNITDKDFTLFTCEAYLSDKDIDISLFREPISIEDGELGIE
EVSKSKISIYPNPTADFVNIHTIETDINYTDIYDSSGKKLKTSRLKSIDLSYLPSGVYFI
SIKTKNKETHLFKILKK
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggatagcggaactaaaaattcatatatttgccaaaaaataaagctattgaaaacattt
ctatattttctattttttacattttactcttttttaaatgctcaaggcataatagcctct
gagaaggaagtgttggttcaaatttatcagcaaactgatggcaaaaactggaatagaact
tgggatttgtctgccgacccgtcagaatggtttggcgtcaatacaaataacggaagtgtt
acagaactacgactgaacggaaatttgcttcacggaaagctcccttctcttacaggatta
aaaaacctcaaagttttagacctaagtagtaaccacttatctggagatctaccttctata
aataatttgaatcaattagaactactagatttatcaaataataattttgaaggagatgtt
tcaaatcaatttacaaatttaacccaactccatacactaagtttaggcaacaataaacta
tctttgtctacacctgatacttttttaaactcatttttaaatttaaaagtattggattta
tctaactttaatttacaggaaataccatctagagtttcatctttaaattttattcaggag
cttaatctatctggcaatcccattaagagtggattttctcatttatcaaaactaaaatca
ttaaaaaaactagatttatcttctactcaaatggaagctattcctgcagaagtcaactca
ttaacacagctaatctcactcaatttaagcaaaaacaatttaaaagaaaatagcattaac
ggcattgaaaaccttaatctattagaatggctctcattagaccaaaaccatttaaatagt
attcctcctgcattaggaaaattagaaaatctagtatatctcaatttgtcgggtaataat
ctgaaagagaatttcgccattattaaacatctatcctctctacaatatctaaacctttca
cacaatcaaatcgaaggcaatttccctaacgaactatcacaactagagaaacttatgttt
ttatctctaagcggaaatcaacttacaggagagttgcctaacccattacctcctattacg
gatattagtaataatagatttacatcagttcatataaaacagtatctaatacactcctct
caaagagtagattttacatactctccacagagatatgacgaacccactgctataaaaact
aaaattggagcttctgttaacttaactcaatcattagaatctagccaagggtattctttc
caatggttaaaaagcctagacactaaaaccaatgttagctctgaaaacctaagactaaat
aatattacagataaagatttcacactttttacttgtgaagcttatctatctgataaagat
attgatatatctttgtttagagaacccatcagtattgaagatggagaacttggcattgaa
gaagtttctaaatctaaaatttctatctaccctaatcctaccgcagatttcgttaacata
cacaccatcgaaacagatataaactacaccgatatctatgattcttcagggaagaaactt
aaaacctctcgccttaagtctatagacctctcttatttaccgtcaggggtttactttatt
agtattaaaacaaaaaataaagaaactcatttatttaaaattcttaagaagtag

DBGET integrated database retrieval system