KEGG   Riemerella anatipestifer RA-CH-1: B739_2067Help
Entry
B739_2067         CDS       T02331                                 

Definition
(GenBank) hypothetical protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rag  Riemerella anatipestifer RA-CH-1
Pathway
rag00061  Fatty acid biosynthesis
rag00780  Biotin metabolism
rag01100  Metabolic pathways
rag01130  Biosynthesis of antibiotics
rag01212  Fatty acid metabolism
Module
rag_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rag00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B739_2067
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    B739_2067
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    B739_2067
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rag01004]
    B739_2067
Enzymes [BR:rag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     B739_2067
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     B739_2067
Lipid biosynthesis proteins [BR:rag01004]
 Fatty acid synthase
  Component type
   B739_2067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short CactinC_cactus
Motif
Other DBs
NCBI-ProteinID: AFR36649
UniProt: J9R459
LinkDB All DBs
Position
complement(2162731..2163549)
Genome map
AA seq 272 aa AA seqDB search
MSYGLLKGKKGIIFGALNEQSIAWKVAERCHEEGAEFILSNAPIAMRMGELNALAEKTGA
EVIGADATSMEDLEKLFDAAIEKFGKLDFILHSIGMSVNVRKGKPYTDLNYSFLEKGWDV
SAVSFHKVMKTAWDKDCMNEWGSILALSYIAAQRTFPDYNDMADNKSYLESIARSFGYYW
GERKVRVNTISQSPTPTTAGSGVKGFGGFLGYAEDMSPLGNATALDCANYCVAMFSDLTR
KVTMQNLFNDGGFSNTGVSQKVVDRYDQSKEG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcatacggattattaaaaggaaaaaagggaattatatttggagctcttaacgagcaa
tctatcgcttggaaagtagcagaaagatgtcatgaagaaggtgctgaatttatcttatct
aatgcacctatcgctatgagaatgggagaactaaacgctttggcagaaaaaacaggagca
gaggtcattggtgcagacgccacttctatggaagatttagaaaaactttttgatgctgcg
atagaaaaatttggaaagctagattttattttacactctataggaatgtcggttaatgtg
agaaaaggtaagccttatactgaccttaattatagctttttagaaaaaggttgggatgta
tcggcagtttcttttcacaaagttatgaaaaccgcttgggataaagattgtatgaacgag
tggggttctattttagcgctttcttatattgcagctcagagaactttcccagactataat
gatatggcagataacaaatcttatttggagagtattgcgagaagctttgggtactattgg
ggtgaaagaaaagtaagagtaaacaccatatcacaatctccaacacctacaacagcggga
agcggagtgaaaggctttggaggtttcttaggttatgcagaagatatgtctccactaggt
aatgcaacagctttagattgtgctaactactgcgtggcaatgttttctgatttaacaaga
aaggtaacaatgcaaaatcttttcaacgacggaggatttagcaatactggggtttctcag
aaggtggtagatagatatgatcaaagtaaagaaggttaa

DBGET integrated database retrieval system