KEGG   Rahnella sp. Y9602: Rahaq_0207Help
Entry
Rahaq_0207        CDS       T01422                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00564  Glycerophospholipid metabolism
rah01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rahaq_0207
Enzymes [BR:rah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Rahaq_0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 NAD_binding_8 HI0933_like 3HCDH_N GIDA Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADW71837
UniProt: A0A0H3F4Y2
LinkDB All DBs
Position
complement(237309..238820)
Genome map
AA seq 503 aa AA seqDB search
METKDLIVIGGGINGTGIAVDAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHQPHLRPAWMIRAGLFLYDHLGKRTSLPAS
KGLKFGSESVLKPELTKGFEYSDCWVDDARLVVVNAQEVEERGGEVRTRTRVTRAWREDG
MWMVEAEDIDTGKTFTWRAKGLVNATGPWVKHFFDDGLKLKSPYGIRLIKGSHIVVPRAH
NQPQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYHGDPKDVKIDDKEIGYLLKVYNDHF
KKQLTTEDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVHDQDGKAPLLSVFGGKLTTYRK
LAEHALEKLVKYYPKAGPAWTKTAVLPGGKLNGDRDTYSANLRSRFKWLPESLARRYART
YGSQTELFLNDATSLESLGEDFGHGFYEAELRYLVEKEWVSQLDDAIWRRTKLGMWLDKT
QQQRVAEWLETHKQQKKHLSLAS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgtaattggtggcggtattaatggtaccggcatcgcagtc
gacgcagctggccgcgggctgtctgttctgctgcttgaagcgcaagacttggcctgcgcg
acctcttcggccagttctaaactgatccacggtggcctgcgctatctggaacattacgaa
ttccgtctggtcagcgaagcgctggctgaacgtgaagtgctgttgaaaatggcaccgcat
attgctttcccgatgcgtttccgtttaccgcatcagccgcatttgcgcccggcctggatg
atccgcgccggtttgttcctgtacgaccatctgggcaaacgcaccagcctgccggccagt
aaaggtctgaaattcggcagcgagtccgtgctgaaaccagaactgaccaaaggttttgaa
tactcggattgctgggtcgacgatgcgcgtttagtggtcgtcaatgcacaggaagtggaa
gaacgtggcggcgaagttcgtacccgcacccgcgtgacccgcgcatggcgtgaggacggc
atgtggatggttgaagccgaagatatcgacaccggcaaaaccttcacctggcgcgccaaa
ggtctggtgaacgctaccggtccgtgggtaaaacatttcttcgacgacggcctgaagctg
aaatcgccatacggcatccgtctgatcaaaggcagccatattgtggtgccccgtgcacac
aatcagccgcaggcctacattctgcaaaacgaagatcaccgcattgttttcgtgatcccg
tggatggatgaattctccatcatcggcaccaccgacgtggaatatcacggcgatccgaaa
gacgtgaaaatcgacgataaagaaatcggttatctgctgaaagtgtataacgaccacttt
aagaaacagctgaccaccgaagacatcgtctggacttattccggcgtgcgcccgctgtgc
gatgacgaatcagattcaccacaggcggtgacccgcgattacacgctcgacgttcacgat
caggatggcaaagcgccgctgctttctgtattcggcggcaagctgaccacctaccgtaaa
ctggcagaacacgcgctggaaaaactggtgaagtactatccgaaagccggcccggcgtgg
accaaaacggccgtgctgcctggcgggaaactgaacggagaccgtgatacctacagcgcc
aatctgcgttcccgcttcaaatggttaccggaatcactggcacgccgttatgcgcgtacg
tacggcagccagacagagttattcctgaatgacgcgaccagccttgaatcgctgggcgaa
gatttcggtcacggattctacgaagctgaactgcgttatctggtggaaaaagagtgggtt
tcacagcttgatgatgccatctggcgtcgtaccaaactcggtatgtggctggataaaacc
cagcaacaacgcgtcgccgagtggctggaaacgcacaaacagcagaagaaacatctgtcg
ctggcgtcttga

DBGET integrated database retrieval system