KEGG   Rahnella sp. Y9602: Rahaq_0263Help
Entry
Rahaq_0263        CDS       T01422                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00550  Peptidoglycan biosynthesis
rah01100  Metabolic pathways
rah01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rah00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rahaq_0263
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Rahaq_0263
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rah01003]
    Rahaq_0263
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rah01011]
    Rahaq_0263
Enzymes [BR:rah01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Rahaq_0263
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Rahaq_0263
Glycosyltransferases [BR:rah01003]
 Polysaccharide
  Bacterial polysaccharide
   Rahaq_0263
Peptidoglycan biosynthesis and degradation proteins [BR:rah01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Rahaq_0263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase OstA_2
Motif
Other DBs
NCBI-ProteinID: ADW71893
UniProt: A0A0H3F4Q7
LinkDB All DBs
Position
complement(298773..301328)
Genome map
AA seq 851 aa AA seqDB search
MKFVKYLLILAVCCILLGAASIFGLYKYIEPQLPDVATLKDVRLQTPMQVFSAEGDLIAQ
YGEKRRIPLKLDQIPPELVHAFIATEDSRFYEHHGVDPIGIFRAASVALVSGHASQGAST
ITQQLARNFFLSPERTLTRKIKEAFLAIRIEQMMSKDEILELYLNKIYLGYRAYGVGAAA
QVYFGKNVNQLTLSEMAVIAGLPKAPSTFNPLYSHDRSLARRNTVLARMLDEKYITQAQY
DQARAEPLVANYHAPHIEFSAPYLTEMVRQEMVKRYGDNAYNDGYMVYTTITKKTQLAAQ
EALRTNVLNYDMRHGYRGPSNQLWKVGEPAWDQDKIVQSLKTLPVYGPLFPAVITATDDA
QATATMSNRAVISLPFSGMRWARPYRNDNAQGPTPKKVTDVVRPGQQVWVRKVGDDWWLA
QVPDVNSAIVSLNPNDGAIEALVGGFDFNQSKFNRANQAVRQLGSNIKPFLYTAAMDKGL
TLATILNDMPITRWDAGAGTDWRPKNSPPTYYGPIRLRQGLGESKNVVMVRAMRAMGVDY
AAEYLQRFGFPAANIVHSESLALGSASFTPLQVVRGYATLTNGGYLVDPYFITKIVDESG
QVQFEAKPKIACRTCNIPVIYGDTQKSAVLSDDNVENVATSTINNNTSVPTPQLEQVPPN
SPQVDAAQQYAPHVISTPLSFLISDALNSNIFGEPGWMGTGWRAGRDLKRHDIGGKTGTT
NSSKDAWFSGYGPDVVTSVWIGFDDHRRDLGRSTASGVIPDQISGAEGGAKSAQPAWDDY
MKAVLEGVPEQPQTPPPGVVTVTIDKSTGKLSDGGGNSRPEYFIDGTQPTEHAVHEVGTT
IMDNGQEHELF
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaagtatttattgattcttgcagtgtgttgcattttgctgggagccgcc
tcgatcttcggtttgtataaatatatcgagccacagctacccgatgtcgccacgcttaaa
gacgtgcgcttgcaaacaccgatgcaagttttcagtgccgagggtgatttaatcgctcaa
tatggtgaaaagcgccgtatcccactgaaactcgaccagatcccaccggaactggtgcat
gcgtttatcgcgacagaagacagtcgtttctatgaacatcacggcgtggacccgatcggt
attttccgtgcggcttccgttgcgctggtgtccggccacgcctcacagggcgcgagtacc
attactcagcaactggcccgtaacttcttcctgagtcctgaacgcacgctgacccgtaaa
atcaaggaagcatttctggccatccgcattgagcagatgatgtccaaagatgaaatcctt
gagctgtatctgaataaaatctatctcggttatcgcgcttatggcgtgggtgccgctgca
caggtttacttcgggaaaaatgtcaaccaactgacgctcagtgaaatggcggtgattgcc
ggtctgccaaaagcaccgtcaaccttcaatccgctgtattctcacgatcgttctctggcg
cgtcgcaacaccgtactggcgcgtatgctggatgagaaatacatcacgcaggcccagtac
gatcaggcgcgtgctgagccgctggtggcgaattatcatgctccacatatcgagttttct
gcgccgtatctgaccgaaatggtgcgtcaggagatggtgaaacgttatggcgacaacgct
tataacgatggctacatggtttacaccaccattaccaagaaaacccagctggccgcgcag
gaagccctgcgcaccaacgtgctcaattacgatatgcgccacggttaccgtggcccgtca
aatcagttatggaaagtgggtgaacctgcgtgggatcaggacaagattgttcagtcgctg
aaaaccctgccggtgtatggcccgctgttcccggccgttatcaccgcaacggacgacgct
caggcgacggcaacgatgtccaaccgcgcggtcatcagcctgccattcagcggcatgcgc
tgggcgcgaccttaccgtaatgacaatgctcagggcccgacaccgaaaaaagtcactgac
gtggtgcgccctggtcagcaagtttgggtacgtaaagtgggtgatgactggtggctggcg
caggtgcctgatgtcaactcagccatcgtttcactcaatccaaacgacggtgccattgaa
gcactggtcggcggctttgacttcaaccagagtaagtttaaccgcgccaatcaggcggtt
cgtcagctcggttcgaacatcaaacctttcctgtataccgcagcaatggataaaggcctg
acgctggcgactatcctgaatgacatgccaatcacccgctgggatgccggtgccggtacc
gactggcggccgaagaactccccgccaacgtattacggtccgatccgtttacgtcagggt
ctgggcgagtctaaaaacgtggtgatggtgcgtgcgatgcgtgcgatgggtgtggattac
gcggctgaatatctgcagcgttttggcttcccggcggcgaacattgttcattccgaatca
ctggcattgggttctgcttcattcactccgttacaggtggtgcgcggttacgccacactg
accaacggcggttatctggttgacccgtatttcatcaccaaaatcgtggatgaatccggc
caggttcagtttgaagccaaacctaaaatcgcctgccgtacctgtaatattccggttatt
tatggggatacgcagaaatctgccgtgctgtcggatgacaacgtagaaaatgttgctacg
tccaccatcaataacaataccagtgtgccaacgccacaacttgagcaggttccgccgaac
tcgccacaggttgatgccgcacagcaatacgcaccgcatgtgatcagtactcctctgtca
ttcctgatcagtgatgcactgaactccaacatcttcggggaaccgggctggatggggacg
ggctggcgcgcaggacgcgacctgaaacgtcacgacattggcggcaaaaccgggacaacc
aacagctcgaaagatgcctggttctccggatatggccctgacgtggtgacatcagtctgg
attggctttgacgatcaccgtcgtgatttgggccgttcgacggcttccggtgtcatcccg
gatcaaatctccggtgccgaaggcggcgcgaaaagtgctcagccagcctgggatgattac
atgaaagccgtgctggaaggagtgccggaacagccacagactccgcctccgggtgtggtg
accgtcactatcgataagagtaccggtaagctttctgacggcggcggtaacagtcgcccg
gaatactttatcgacgggactcagccgacagaacatgctgtacatgaggtcggaacaacc
atcatggataacggtcaggaacacgaactgttctga

DBGET integrated database retrieval system