KEGG   Rahnella sp. Y9602: Rahaq_0481Help
Entry
Rahaq_0481        CDS       T01422                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00790  Folate biosynthesis
rah01100  Metabolic pathways
Module
rah_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rah00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rahaq_0481
Enzymes [BR:rah01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Rahaq_0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF3234
Motif
Other DBs
NCBI-ProteinID: ADW72110
UniProt: A0A0H3F4I2
LinkDB All DBs
Position
514417..515256
Genome map
AA seq 279 aa AA seqDB search
MHLTARESRLDLTYPQVMGILNVTPDSFSDGGRHNTLDLALRHAQAMVDAGATILDIGGE
STRPGAAEVSEDEELARVVPVVEAIAQRFDVWISVDTSKAAVIREAANAGMHLINDIRSL
QEPGALQAAAETGLPVCLMHMQGDPKTMQHAPHYDNVVAQVDQYFFEQIARCVNAGIAKE
KLLLDPGFGFGKNLEHNYQLLARLAEFHHFGMPLLVGMSRKSMVGQLLHVSPEKRVTGSV
ACAVIAAMQGAKIVRVHDVKETVEAMRIVEATLSARDKN
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcacctcactgccagagagtccagattggatctcacttacccccaggttatggggatc
ctgaacgttacccccgactcattttccgatggcgggcgacataacacgcttgatcttgct
ctcagacatgctcaggcaatggttgatgcaggcgcgacaattctcgacatcggtggtgaa
tcgacccgccctggtgcagcagaagtcagcgaagatgaggaactggcccgtgtggtgccg
gtagtcgaagccattgcgcagcgttttgatgtctggatctccgtcgatacctcaaaagcc
gccgtgatccgtgaagcggcaaatgcgggcatgcatctgatcaacgatatccgttcactt
caggagcccggtgcgctacaggctgcggccgaaacaggtttgcctgtttgtctgatgcac
atgcagggtgaccccaaaacgatgcagcatgccccgcattacgacaatgtcgttgcgcag
gtggatcagtatttttttgagcaaattgcccgttgtgttaacgccggcattgcgaaagag
aaattgttgctcgatccgggcttcggtttcggtaaaaatttggagcataactatcagttg
ctcgcacggttggctgagtttcatcactttggcatgccattgttagtggggatgtcgagg
aaatccatggtggggcaacttctgcatgtttctcctgagaaacgggttaccggaagtgtt
gcttgtgctgtgatcgctgccatgcaaggtgctaagatcgtgcgtgtacatgatgtaaaa
gaaaccgttgaagcgatgcgtatcgtggaagcgacactttctgcaagggataaaaactaa

DBGET integrated database retrieval system