KEGG   Rahnella sp. Y9602: Rahaq_0985Help
Entry
Rahaq_0985        CDS       T01422                                 

Definition
(GenBank) Xylose isomerase domain-containing protein TIM barrel
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00040  Pentose and glucuronate interconversions
rah00051  Fructose and mannose metabolism
rah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rahaq_0985
   00051 Fructose and mannose metabolism
    Rahaq_0985
Enzymes [BR:rah01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Rahaq_0985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ADW72609
UniProt: A0A0H3F6S0
LinkDB All DBs
Position
1048576..1049556
Genome map
AA seq 326 aa AA seqDB search
MSELKFATRLNSFASGAHLYWPEQKGKPSVLQMIERAATVKGLTHLDLNYPQHMTGDITL
MRQKIEEVGLAVNGMQMRWDAPEFKIGAFTHPDPKIRRQAIELTKRGIDAGREFGASIMT
LWMGQDGFDYCFQADYKKIWEDAVSAVREVAEYAPDIDVSIEYKPNEPRAYSIFPNATTC
LLAVEEAGCKNLGITLDFAHVLFANEVPAFAAAMVARRSRLLGLDLNDGWGKRDDGLMVG
SVNPRATLEFLLQMKRDGYKGAYYFDTFPDASGLDPVREAETNIATVIRLLKLCEKLENN
PALNEAISRQDAVATQQIVNDVMLAQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacttaaatttgccacacgtctgaactcgtttgcgtcgggggcacatctttac
tggcctgaacagaaaggcaaaccttcagtgctgcaaatgatcgaacgtgcagctacggtt
aaaggattgacgcatctggacctgaattatccgcagcacatgaccggcgatatcactttg
atgcgccagaaaatcgaagaagtcgggctggcggtgaacgggatgcaaatgcgctgggat
gctccggaatttaaaatcggcgcatttactcacccggatccaaaaattcgtcgtcaggcg
attgaattgaccaaacgcgggatcgacgccggtcgtgagtttggtgccagcattatgacg
ttgtggatgggacaggatggctttgattactgtttccaggctgactacaaaaaaatctgg
gaagacgcagtcagcgctgtgcgtgaagtggcggaatacgccccggatatcgacgtcagc
attgaatacaaacccaacgaaccacgcgcttacagcattttcccaaatgccactacctgt
ctgctggcggttgaagaagccggttgcaagaacttaggtatcacactggatttcgcgcat
gtgttgtttgccaacgaagtaccggcgtttgcggcggcgatggtagcccgccgttcgcgt
ttgctggggctcgatctcaatgacggctggggcaaacgcgacgacggcctgatggtcggc
tccgtcaacccgcgtgccacgctggaattcctgttgcagatgaaacgcgacggctataaa
ggcgcgtattacttcgataccttcccggacgccagcggattggatccggtgcgtgaagca
gaaaccaatatcgcgaccgtgatccgtttactcaaactttgcgaaaaactcgagaataac
ccggcgctgaatgaagccatcagcaggcaggacgccgtagccacacagcaaatcgtcaac
gacgtgatgttggcgcagtaa

DBGET integrated database retrieval system