KEGG   Rahnella sp. Y9602: Rahaq_1615Help
Entry
Rahaq_1615        CDS       T01422                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00052  Galactose metabolism
rah00500  Starch and sucrose metabolism
rah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Rahaq_1615
   00500 Starch and sucrose metabolism
    Rahaq_1615
Enzymes [BR:rah01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Rahaq_1615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ADW73237
UniProt: A0A0H3FE02
LinkDB All DBs
Position
1770291..1771724
Genome map
AA seq 477 aa AA seqDB search
MTYTIAHAEQELQAKHGRVNLRWYPRYHLAARAGWINDPNGLIWFEGWYHAFYQHHPYST
QWGPMHWGHARSKDLLHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
AGNDENLYQVQCLATSGDGIHFKREGIIIDTPADLHHFRDPKVWREGDSWYMVVGARVGD
TGQIRLYRSADLRQWQDEGILDEAEAGMGFMWECPDFFTLNGKRVLMFSPQGIAAQGFEN
RNLFQSGYLVGDWQPGEPFVRAGEFVEMDHGHDFYAPQSFLTPDGRRIVIGWLAMWESPM
PEQQDGWAGMLSLPRELSLDENNRLQMRPAKEVEALRQAWFPWPVSTLKNQQILMAEKGE
SMEVALHWDGARSDAEQYGLSLGDGLRVYVDTQMQRLVLERRYPQYGLCGTRSVPLVPGA
PLALRVFIDSSSVEVFVNDGQACLSSRIYPDAGRRELNLFAWHGTATLSDAGAWQLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgtatacaattgctcatgctgaacaggaacttcaggctaagcacgggagggtaaat
ctgcgctggtacccgcgctatcacctggccgcgagggctggctggattaacgatcctaat
ggcctgatctggtttgagggttggtatcacgctttttatcagcatcatccgtattccacc
cagtggggaccgatgcactggggacatgcgcggagcaaagatttgcttcactgggagcac
ttgcccgttgcactggccccggaaggaccggaagacaaagacggctgtttttcgggttcg
gcggtggtggatggcgataccctggcgctgatttacaccgggcataaatttcacggcgac
gccggtaatgacgaaaacctttatcaggtgcagtgcctggcaaccagtggcgatggtatt
cactttaaacgtgaggggatcattatcgataccccggcggacttgcatcatttccgcgac
cctaaggtctggcgcgaaggggatagctggtacatggtcgtcggtgcgcgcgttggcgat
accgggcaaatacggttgtatcgttcagccgacctgcgtcagtggcaggatgaagggatc
ctggatgaggcagaagccggtatgggctttatgtgggagtgccctgatttctttaccctt
aatggtaaacgcgtcctgatgttttctccgcaggggatagccgcgcagggttttgagaac
cgtaatctgttccagagcggttatctggtgggggactggcagcccggcgagccgtttgtc
cgtgctggagaatttgttgaaatggatcacgggcacgacttctatgccccgcagagtttc
ctgacgccggatggccgccgcatcgtgattggctggctggctatgtgggagtcgccgatg
ccggagcaacaggacggctgggcggggatgctgtctctgccgcgtgagctgagtcttgat
gagaacaatcgtctgcagatgcgtcccgcgaaagaggtggaagcactgcgtcaggcctgg
ttcccgtggcctgtcagtaccttgaaaaatcagcagatcctgatggcggaaaaaggggag
tcgatggaagttgcgcttcactgggatggcgcacgcagtgatgcggagcagtatggactt
agcctgggggacggtttacgtgtctatgttgatacccagatgcagcgtctggtgctggag
cgccgctatccgcagtacggattatgtggcacgcgcagcgtaccgttagtgcccggcgct
cctctggctttacgtgtgtttatcgacagctcatccgtcgaggtatttgttaatgacggc
caggcctgcctcagtagccggatatatcctgatgccggtcgccgcgaattaaatttattt
gcctggcatggaacggcaacattatccgatgccggagcctggcagctggaataa

DBGET integrated database retrieval system