KEGG   Rahnella sp. Y9602: Rahaq_2765Help
Entry
Rahaq_2765        CDS       T01422                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rahaq_2765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rah02000]
    Rahaq_2765
Enzymes [BR:rah01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Rahaq_2765
Transporters [BR:rah02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rahaq_2765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_2 GST_N_3 GST_C_3 GST_C_2 Tom37 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ADW74368
UniProt: A0A0H3FBE1
LinkDB All DBs
Position
3009225..3009830
Genome map
AA seq 201 aa AA seqDB search
MKLYYKPGACSLSPHIILREAGLDFSIEKVDLATKKTETGDDFLAVNPKGQIPTLLLNDG
SILTEGVAIVQYLADQKPDRQLMPEQGTLARYHALEWLNYIATELHKGFSPLFNPKAPEE
FKTLTREALSKKFAYVNTALKDNHFLLGTRFSVADAYLFTVMGWAKALKFDLSALTELNA
YLDRVAARPAVDAALSAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtattataaacccggagcctgttccctttcccctcatatcatcctgcgtgaa
gcgggtctggacttcagcattgagaaggttgatctggcgaccaagaaaacagaaaccggt
gatgacttcctcgcagtgaaccccaaggggcagatccccacgctgttactcaatgatggc
agtattctgaccgaaggcgtggctatcgtgcagtatctggcagaccagaaaccagaccgt
cagctgatgccggaacaaggcacgctggcccgttatcacgcgctggaatggctgaactac
attgcaactgagctgcataaaggtttctcgccattgtttaatccgaaagcccccgaagag
ttcaagacattaacccgcgaagcactgagcaaaaaatttgcttacgtgaataccgccctc
aaagacaatcatttcctgctgggtacgcgtttcagcgtggcagatgcttacctgtttacc
gtgatgggttgggcgaaggcactgaaatttgatctgagcgcactgacggaactgaacgcc
taccttgaccgcgttgccgcacgcccggctgttgatgcggctctgtcggctgaaggtctg
aaataa

DBGET integrated database retrieval system