KEGG   Rahnella sp. Y9602: Rahaq_3065Help
Entry
Rahaq_3065        CDS       T01422                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00473  D-Alanine metabolism
rah00550  Peptidoglycan biosynthesis
rah01100  Metabolic pathways
rah01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Rahaq_3065
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rahaq_3065
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Rahaq_3065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rah01011]
    Rahaq_3065
Enzymes [BR:rah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Rahaq_3065
Peptidoglycan biosynthesis and degradation proteins [BR:rah01011]
 Precursor biosynthesis
  Amino acid ligase
   Rahaq_3065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST ATP-grasp_3 PTS_2-RNA GARS_A
Motif
Other DBs
NCBI-ProteinID: ADW74659
UniProt: A0A0H3FC95
LinkDB All DBs
Position
complement(3316666..3317763)
Genome map
AA seq 365 aa AA seqDB search
MSKLRVGIIFGGKSAEHEVSLQSAKNIVDAIDKQRFDVTLLGIDKKGEWHINDASNYLIN
AENPSLIALNRSNNQVALIPGQTENQLIETHSASALSQVDVIFPIVHGTLGEDGSLQGLL
RMANIAFVGSGVLGSAVSMDKDVTKRLLRDAGLAVAPFVCLTRANRQKNTFASVSQQLGL
PLFIKPANQGSSVGVSKVSDEDGYQRALDKAFSFDHKVLVESAIKGREIECAVLGNDHPQ
ASVCGEVILHDEFYSYDTKYINESGASIAVPADLPRETHDRIRAIALQAFQVLECRGMAR
VDVFLTEQGDVVINEINTLPGFTNISMYPKLWAASGLSYSELITRLIELALEQHQQDNQL
KSSAN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaattacgggttggtattattttcggtggtaaatcggcagagcatgaagtgtca
ctgcagtcggcaaaaaacattgtggatgcgattgataaacaacgctttgatgtgacattg
ctgggcattgataagaaaggggaatggcatattaatgatgccagtaactacctgatcaat
gctgaaaatccgtcgctgattgccctgaaccgctcgaataaccaggttgcactgatcccc
ggtcagactgagaatcagttaattgagactcacagcgccagcgcgttgtcgcaagtggat
gtgatcttcccgatagtgcacggaacgctgggggaagacggttccttgcaggggctgctg
cgcatggcaaatattgccttcgtggggtccggcgtgctgggttccgccgtgagcatggat
aaagatgtcaccaagcgtttgctgcgcgatgccggtctggctgttgccccgtttgtgtgc
ctgacacgtgcgaaccgtcagaaaaatacctttgccagtgtttcgcaacaactcggtctg
ccgctttttatcaaacctgcgaatcagggctcatcggtgggcgtcagtaaagtcagtgat
gaagatggctatcagcgtgcgctggataaagccttcagcttcgaccacaaagtgctggtg
gaatcggccattaaaggtcgtgaaattgaatgcgctgtgttgggtaacgatcacccgcag
gccagtgtgtgtggcgaagtgatcctgcacgacgagttttattcctacgataccaaatac
atcaacgaatccggtgcttccattgcggttccggctgatttaccccgtgagacccacgac
cgtatccgcgccattgccttgcaggcatttcaggtgctggaatgtcgcggcatggcgcgt
gtggacgttttcctgacagaacagggcgatgtcgtcatcaatgaaatcaatacattgccg
ggcttcaccaacatcagtatgtatccgaaactctgggcagccagcgggttaagttacagt
gagctgatcacccgcctgattgagctggcgctcgagcaacatcagcaggataaccaactg
aagagttctgccaactga

DBGET integrated database retrieval system