KEGG   Rahnella sp. Y9602: Rahaq_3466
Entry
Rahaq_3466        CDS       T01422                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00052  Galactose metabolism
rah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Rahaq_3466
Enzymes [BR:rah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     Rahaq_3466
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C TrkA_N Glu_dehyd_C 2-Hacid_dh_C Shikimate_DH Methyltransf_25 3HCDH_N MTS PrmA CoA_binding UDPG_MGDP_dh_N ELFV_dehydrog Methyltransf_31 F420_oxidored Pyr_redox_2 Sacchrp_dh_NADP XdhC_C Pyr_redox AAA_27 Met_10 GFO_IDH_MocA ADH_N_2
Other DBs
NCBI-ProteinID: ADW75058
UniProt: A0A0H3FG86
LinkDB
Position
3745748..3746797
AA seq 349 aa
MKSVVVHADSRITIEEQPAPTLSAPDEVLVRIAYSGLCGSDIPRIFASSSHFYPITLGHE
FSGHVVSTGEEVSDLYEGDAVACVPLLPCFQCEECRKTAYSQCKHYQFIGSRRSGGHAEF
IVVSRKNLFKLPENFSLLQGAFLEPLTVGLHALKLAGGCEGKEVIVIGAGTIGQLLIQAA
SALGAKSVTAIDINPQRLSLAQETGASHVYNSAICNADEIRQQTHERRFNQLIIETAGTA
QTVALSLNIAGPKAQIALVGTLHKDLTLDVTTFGHILRKELTLLGSWMNYSSPWPGSEWR
LAIQLFAENKLNLAPLIASVARPAEFVRDVTALAGKPMTGKILLDMTGG
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaatcagttgttgtacatgctgacagcaggataactattgaagagcaaccggctccc
acgctgagtgcacccgatgaggttctggttcgcattgcctactccgggctttgcggatcc
gatatcccgcgtattttcgccagcagttcacatttttatcccatcacattaggccacgaa
ttcagtggtcacgtcgttagcaccggagaagaagtcagcgatttatatgagggggatgcc
gtggcctgcgtacctttattgccatgctttcagtgcgaagagtgccgcaaaacagcgtat
tcccaatgtaagcattatcaatttattggctcccgacggagtggcggccatgctgaattt
atcgtggtttcgcgtaaaaacttatttaaattgccggagaatttttcacttctgcaaggc
gcttttttggaaccgctcaccgttggcttgcatgccctgaagctggcaggaggctgtgag
ggtaaagaagtgatagtcattggagccggcaccatcgggcagttgcttattcaggcagcc
agcgccctgggggctaaatcggtgacagcgatcgatatcaatccgcagcgcctttccctg
gcgcaggaaacaggtgccagccacgtttataacagcgcaatatgcaacgccgatgaaatc
cgccagcaaactcatgaacggcgctttaatcagctgattattgaaacagcaggcacagcg
caaaccgtggccttgtctctcaatatcgcaggccccaaagcgcaaatcgcgctggtcggc
accttacacaaagacctgactttagacgtcactactttcggccatatcctgcgcaaagag
ctgaccttgctcggcagttggatgaactattcctctccgtggccgggcagtgagtggcga
cttgccatacagctttttgctgagaataaactaaacctggcccccctgatcgccagtgtt
gcccgtcccgcagagtttgtcagggacgtcacggcactggctggcaagccgatgacggga
aagattttgctggatatgacgggaggctaa

DBGET integrated database retrieval system