KEGG   Rahnella sp. Y9602: Rahaq_4301Help
Entry
Rahaq_4301        CDS       T01422                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00620  Pyruvate metabolism
rah00680  Methane metabolism
rah01100  Metabolic pathways
rah01120  Microbial metabolism in diverse environments
rah01200  Carbon metabolism
Module
rah_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rahaq_4301
  09102 Energy metabolism
   00680 Methane metabolism
    Rahaq_4301
Enzymes [BR:rah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Rahaq_4301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADW75887
UniProt: A0A0H3FF02
LinkDB All DBs
Position
4708202..4710847
Genome map
AA seq 881 aa AA seqDB search
MNEQYSAMRSNVSTLGKLLGDTIKDTLGEHILDRVEKIRKLSKSSRAGNDADRQELLSTL
QNLSNDELLPVARAFSQFLNLANVAEQYHSISPHGEAASNPEALAQLFDRLKSKNLSEQQ
LRDAVDQLSIELVLTAHPTEIARRTLIHKLVEVNNCLKQLDHNDLADYERKQIMRRLRQL
IAQSWHTDEIRKNRPSPVDEAKWGFAVVENSLWEGVPAFLRELNEQLETSLDYKMPVEAV
PVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLRDIAVLVSELSMTECTPELRE
LAGGADIIEPYREIMKQLRSQLTNTQVYLEARLKGERVARPHDLLVKNDQLWAPLYACYQ
SLQACNMGIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDAIAEITRYLGLGDYESW
SESDKQAFLIRELNSKRPLVPRHWEPSANTKEVLDTCQVIAEAPEGSIAAYVISMARTPS
DVLAVHLLLKEAGCPFPMPVAPLFETLDDLNNADDVMKQLLSIDWYRGFIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGIALTLFHGRGGSIGRGGAPAQAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYTSAILEANLLPPPEPKQAWVDIMEQLS
DVSCKMYRGYVRENKDFVPYFRAATPEQELAKLPLGSRPAKRKASGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQAVVDDGKRDELETMCRDWPFFSTRIGMLEMVFAKADLWLAEY
YDHRLVGKELWPLGQQLRDQLASDIKVILAISNDDHLMEDLPWIAESIALRNVYTDPLNV
LQAELLHRSRELEKDGKQDANVEQALMVTIAGVAAGMRNTG
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaatgtcagtactttaggtaaattgctgggc
gacacgatcaaagatacgttgggagagcatatcctggatcgtgttgagaaaatccgtaag
ctgtcgaaatcctcccgtgccggaaatgacgcggatcgacaggagttactgtcaacgttg
caaaacctctcaaacgatgagctgttgcctgttgcccgtgcttttagccagtttctgaat
ttagccaacgtggctgaacaatatcacagcatttcgccgcacggcgaagcggccagcaat
cctgaagcgctggcgcaattgttcgatcgtctgaaatccaaaaacctctctgagcagcag
ttacgggatgccgttgaccagctttctatcgaactggtgctgaccgcacacccgacagaa
atcgcccgtcgtacgttgatccacaaactggtggaagtgaataactgcctcaagcagctc
gaccataacgatctggccgattacgagcgcaaacaaatcatgcgccgcctgcgtcagtta
atcgcgcagtcatggcataccgatgaaatccgcaaaaaccgcccttctccggtggatgaa
gccaaatggggttttgcggtagtcgaaaacagcctgtgggaaggcgtgccggcttttctg
cgcgaactgaacgaacagctggaaacctcactggattacaaaatgccagtggaagccgtg
ccggttcgcttcacctcctggatgggtggcgaccgcgacggtaacccgaacgtaaccgcc
gatatcacccgtcacgtgctgttgctgagccgctggaaagcgactgatctgttcctgcgt
gatatcgcggtgctggtgtcagaactgtcgatgaccgaatgtacaccggaactgcgtgag
ctggccggcggtgcggacatcatcgaaccttaccgcgaaatcatgaaacagctccgttcg
cagctgaccaatactcaggtgtatctggaagcccgtctgaaaggcgaacgtgttgcacgc
ccgcacgatttgctggtgaaaaatgaccaactgtgggcgccgctttacgcctgctaccag
tcattgcaggcctgcaacatgggcattattgccaacggccagttgctggataccctgcgc
cgcgtgcgctgcttcggcgtgccgctggtgcgtatcgacgtgcgtcaggaaagcacccgc
cacaccgacgctatcgcagagattacccgttatctgggtcttggcgattacgaaagctgg
tcagaatccgacaaacaggctttcctgatccgcgaactgaactcaaaacgtccgctggtg
ccacgtcactgggaaccgagcgccaacaccaaagaagtgctcgatacctgtcaggtgatt
gccgaagcgccggaaggctcgattgcagcgtatgtcatctcgatggcgcgcacgccgtct
gatgtgctggccgtacacctgctgctcaaagaagccggttgtccgttcccgatgcccgtt
gcgccgctgttcgaaacgctcgacgacctgaacaatgccgacgatgtcatgaagcaattg
ctgagcatcgactggtatcgcggtttcattcagggcaaacagatggtgatgattggctat
tccgactctgcaaaagacgcgggcgtgatggccgcatcgtgggcgcaatatcgtgcgcag
gatgctctgatcaaaacctgcgagaaagccggaattgccctgacactgttccacggacgt
ggcggttctatcggccgtggcggcgcaccggcacaggcagcgttattgtctcagcctccg
ggcagcctgaaaggtggcctgcgcgttaccgaacagggcgagatgatccgcttcaagttc
ggtctgccggaagtcactatcagcagtctggcgctgtacacctctgcaattctggaagcc
aacctgctgccaccgcctgagccgaaacaagcctgggtggatatcatggaacaactgtct
gacgtgtcctgcaaaatgtaccgtggctacgttcgcgaaaataaagacttcgtgccttac
ttccgcgccgcaacgccggaacaggaactggccaaactgcctctgggttcacgcccggcg
aaacgtaaagccagtggtggcgtcgaaagccttcgtgccatcccgtggattttcgcctgg
acgcaaaaccgcctgatgctgccagcctggctgggtgccggtgccggtttgcaggctgtg
gttgatgacggaaaacgcgacgagctggaaaccatgtgccgcgactggccgttcttctcc
acgcgaatcggtatgctggagatggtgtttgcgaaagctgacctgtggctggcggaatac
tacgatcatcgtctggttgggaaagaattgtggccgctcggtcagcagttgcgcgatcag
ctggcaagcgacatcaaagtcattctggcgatttctaacgacgatcatctgatggaagat
ttgccgtggattgcagaatccatcgcactgcgaaacgtctacactgacccgctgaacgtc
ttgcaggctgaattgctgcaccgttcccgcgagctggaaaaagacggcaagcaggatgcc
aacgtcgaacaggcgctgatggtgacgattgccggtgtggcagcgggtatgcgtaatacc
ggctag

DBGET integrated database retrieval system