KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0541Help
Entry
RA0C_0541         CDS       T02107                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
rai00620  Pyruvate metabolism
rai00680  Methane metabolism
rai01100  Metabolic pathways
rai01120  Microbial metabolism in diverse environments
rai01200  Carbon metabolism
Module
rai_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RA0C_0541
  Energy metabolism
   00680 Methane metabolism
    RA0C_0541
Enzymes [BR:rai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RA0C_0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFD55518
UniProt: E4T920
LinkDB All DBs
Position
514237..516792
Genome map
AA seq 851 aa AA seqDB search
MEDRKTKLERFEESVLSKYQIYNSIFMTLPFSGVSNVGRFLPLFGEECKKGYQDNKTPTE
IVEEFFKKYAPQSSEKETNDLLFRFIQYIERQVVLFDAIEDAAFSTVNNMDGLGSIRNMK
EKAEARNKVTELKATLQKLKVRPVLTAHPTQFYPDSVLVIINDLTQAIKDNDLTTIKKLL
AQLGKTPFYKKEKPSPLDEAIGLIWYLENVFYHSMGNIYSYLKKHILKDEALKNPVVELG
FWPGGDRDGNPFVKPETTLKVAERLKKSILKNYYKDIRVLKRRLTFKGVEHLVKNLEDQL
YKAAFLEEENTLTLQEFRQSLEEIRAILISEHQSLFVDELDALLYKVDIFGFYFASLDIR
QDSRIHRIVIEDIAKSTSGKIIPENYSSLSCEEQIQVLSQVNGVLDLTSFNQEITKDTLG
SILMMMAIQKENGEKGCNRYIISNNQNAANVLEVYTLLKLCGWQNPTVDIVPLFETIDDL
DNAEEVMTTLYQNKDYKEHLKSRGYQQTIMLGFSDGTKDGGYLKANWSIYTAKERLTKIS
REYGIEVLFFDGRGGPPARGGGKSHQFYASFGKDIESDAIQITIQGQTISSNFGTLDSSQ
YNLEQLISAGVNNKIFTSEQASISSEEKEILQDLADISYQKYTEFKNHPKFIPYLEKMST
LKYYAKANIGSRPSKRGNSDTLNFSDLRAIPFVGSWSQLKQNVPGFYGVGTALAHYDANG
NFEKLKALYKKSLFFRTLLENSMMSLTKSFFKLTEYMKDDVEFGAFWQEIYQEYQLSKEM
LLKLTEFKSLMEDHPAGKASIQMREEMVLPLLTIQQYALKKVQDGSPLSEVYENMVVRSL
FGNINASRNSA
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggaggatagaaaaacaaaactagagcgttttgaagaaagtgtgttatctaaatatcag
atttacaacagtatttttatgacattacctttcagtggtgtgtctaatgtggggagattt
ttgcctctgtttggcgaagaatgtaaaaaaggctatcaagataataaaacacctaccgaa
atcgtagaagagtttttcaaaaaatacgctccacaatcctccgaaaaagaaactaacgac
cttctgtttaggtttatacaatatattgaaaggcaagtagttttatttgatgccatagaa
gatgccgccttttccacagtaaataatatggacggactgggcagtatccgaaatatgaaa
gagaaagccgaagctcgtaacaaggttactgaacttaaagctactctacaaaaacttaaa
gtaagacctgtacttactgctcacccaactcaattctatccagactctgtattggttatc
attaacgatttaacccaagcgattaaagataatgacttaaccaccatcaaaaaacttcta
gcacagctaggtaaaacgcctttctataaaaaggaaaaaccaagtccgttagatgaagct
attgggcttatttggtatttagaaaatgtattttaccattctatggggaatatttacagc
tatcttaaaaaacatattttgaaagatgaagctcttaaaaaccccgtggtagaactaggc
ttttggcccggaggcgatagagatggtaacccttttgtaaaaccagaaaccactctaaaa
gtagcagagagactcaaaaaaagtattctaaaaaactactataaagacatcagagtccta
aaaagaagactcacttttaaaggagtggaacatttagtaaaaaatctagaagaccaactc
tataaagcagcatttttagaagaagaaaacactctaacgcttcaagagttcagacaatct
cttgaagaaatacgagccattttaatctcagaacatcaatctctatttgtagatgagcta
gatgctttactctataaagttgatatctttggattctattttgcaagtctagacatcaga
caagattctagaatccatcgaattgtgatagaagatattgcaaaatctacctctggaaaa
attattcccgagaactattcaagcctttcctgtgaagaacaaatccaagttttatcacaa
gtaaatggtgtgttagacctaacctcatttaaccaagaaatcactaaagataccttaggt
tctatcctaatgatgatggctatccaaaaagaaaatggagaaaaaggttgcaacaggtat
attattagtaataatcaaaacgcagctaatgtactagaggtatataccttactgaagctt
tgtggttggcagaaccctaccgtagatattgtaccactttttgagaccatagatgatttg
gacaatgccgaagaggtaatgacaacgctttaccaaaataaagattacaaagaacacctt
aaatctagaggctatcaacaaaccattatgctcggtttttctgacggaactaaagacggt
ggctatctaaaagccaactggagcatctataccgctaaagaaagacttaccaaaatctct
agagaatatggtatagaagttctgttttttgatgggcgtggtggacctccagctagaggt
ggtggcaaatctcaccagttctatgcttcttttggtaaagatatagagtctgacgctata
caaattacaatacaagggcaaaccattagctctaactttgggactttagactcttcacag
tataatttagaacagcttattagtgctggtgttaataataaaattttcactagtgaacaa
gctagtatttcttctgaagagaaagaaattttacaagatttagcagacattagctatcaa
aaatatacggaatttaaaaatcatcctaagtttatcccgtacctcgaaaagatgagtacg
ctaaagtattatgctaaagccaatataggaagtaggccttccaaaagaggtaattcagat
acactcaactttagtgatttaagagccattccgtttgtgggtagctggagccaactaaaa
caaaatgtacctggtttttatggtgtgggtactgctttggctcattatgatgctaatgga
aattttgaaaaactaaaggcactatataaaaaatctctatttttcagaactttactagaa
aatagtatgatgagccttaccaaatctttctttaaactcacggagtatatgaaagacgat
gtggaatttggtgctttttggcaagaaatttatcaagaataccaactttctaaagaaatg
ctcctaaaacttacagagtttaaaagccttatggaagaccacccagctggtaaagcctct
atacaaatgagagaagaaatggttctgcctctacttaccatacaacaatatgctctaaaa
aaagtgcaagacggaagtcctctttctgaagtttatgaaaatatggtggtaaggtctcta
tttggaaacattaatgcgagtagaaattctgcgtag

DBGET integrated database retrieval system