KEGG   Rothia aeria: RA11412_2027
Entry
RA11412_2027      CDS       T05268                                 

Definition
(GenBank) nitrite reductase [NAD(P)H] large subunit
Organism
raj  Rothia aeria
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox AlaDh_PNT_C NAD_binding_8
Other DBs
NCBI-ProteinID: BAV88326
UniProt: A0A2Z5R1D7
LinkDB
Position
1886383..1887531
AA seq 382 aa
MSQHTTATSGRNILVVGAGPAAWRFVRAYHEGAQDAGRASDTITVLNDEPYIPYDRVAIE
QLFKDTNKDLTLGDPALWDESTINLVSNTRGESLNRESRIVKGSDGVDYPYDVLVFATGS
SAVRIPIPNADSAHVFRTADDVKNMVSEVERLQTKLGRAPRGIVVGGGLLGLEAAEGLKD
LGAEPTILDVAPWLLSVEVDQGGGYAVNAQIKATGIDIETGAFISAINKDASGEVISVSV
ADSTSDEAVIHQIDADLVVFAAGIRPNDELARTAGLETGERGGILVNNACHTSDEHIWAI
GEVACVLGRTWGLVAPPTQWQMRSPRICSKATKMLRSKSSISPRNLSSRVYRSLASVTAA
APRKAASKFSSQTPHAACTRRS
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgtcgcagcacaccactgcaacatcaggccgtaatatactcgttgttggcgcaggcccc
gccgcgtggcgtttcgtacgtgcctatcatgaaggcgctcaggatgccggacgcgcctct
gacaccattaccgttctcaacgatgaaccgtacatcccctacgatcgcgttgcgatcgag
cagctctttaaagacaccaacaaagaccttaccctgggcgacccggcactctgggacgag
tccacgatcaatctggtcagcaacacccgcggcgaatcactcaaccgtgaatcacgcatc
gttaaaggttcagacggcgtagactacccctacgatgtgctcgtgttcgccaccggttca
agtgcggtgcgcatcccgattcctaacgcagattccgcccacgtattccgtaccgcagac
gatgttaaaaacatggtctccgaagttgaacggctgcagactaaacttgggcgcgcaccg
cgcggtattgttgtcggcggaggccttctcgggctggaagccgcagaaggtctcaaagac
cttggtgccgaacccaccatcctcgatgttgccccgtggcttctctccgtggaggtcgat
cagggcggcggttacgcggtcaacgcccagatcaaagcaaccgggatcgacatcgaaacc
ggtgcgttcatatccgctatcaacaaagatgcctcaggcgaggttatctcggtttccgta
gcagattccacctcagacgaagctgttattcaccagattgatgcagacctcgtggtcttc
gcagcgggtattcgccccaacgatgagctggcacgcaccgctggactagagactggcgaa
cgcggcggtattctcgtcaataatgcgtgccacacaagcgatgagcatatctgggctatc
ggtgaagtagcctgcgtacttggacgaacctggggtctggttgccccgccaacgcaatgg
cagatgcggtcgccaagaatctgctcgaaggcaacgaagatgctcaggtcgaagagttcg
atatcgccacgaaacttaagttctcgggtgtacaggtcgctggcttcggtgaccgccgcg
gcaccacggaaggctgcctcgaaattctcttcgcagaccccgcacgcggcatgtaccaga
agatcgtga

DBGET integrated database retrieval system