KEGG   Rothia aeria: RA11412_2097Help
Entry
RA11412_2097      CDS       T05268                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
raj  Rothia aeria
Pathway
raj00473  D-Alanine metabolism
raj00550  Peptidoglycan biosynthesis
raj01100  Metabolic pathways
raj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:raj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RA11412_2097
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RA11412_2097
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RA11412_2097
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:raj01011]
    RA11412_2097
Enzymes [BR:raj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RA11412_2097
Peptidoglycan biosynthesis and degradation proteins [BR:raj01011]
 Precursor biosynthesis
  Amino acid ligase
   RA11412_2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: BAV88396
UniProt: A0A2Z5R1K3
LinkDB All DBs
Position
complement(1960344..1961456)
Genome map
AA seq 370 aa AA seqDB search
MTDKITVALLCGGRSSEHSISLITAVGVLGAIDTAKYEVVPVGITKDGRWYLTDAQELEK
LTAGSDMAEFTGSAQQVFLPLGAGDSRLHLVDSAGHLEFGPAINVVFPLLHGPFGEDGTV
QGLLEMANLPYVGCGVTASAVGMDKHFMKVAFADAGLEVGPYEVVTDRQWRHDRDGALER
VARLGYPMFVKPARAGSSFGITKVDTAEQLVPAIEQARVYDPKVVIEAGIVGREIECGIL
DGHNGDMPRASYPGEIEMQGEQGGFYDFEAKYVSKTTAVTRCPANLPPEDLERMRQLAVK
AFLALDGEGISRADFFYTPDARLIVNEVNTMPGFTPISMYKTMWEKTGIEYKDLIDELLM
LALERPVGLR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataaaattaccgtggctctattgtgtggtgggcgttcttcggagcactctatt
tcgctgattaccgccgtgggggtgcttggcgcgatagataccgccaaatacgaggtggta
cctgtgggcattaccaaggacggccgctggtacctgacggatgctcaagaattggagaag
ctcaccgcaggatcggatatggcagagttcaccggcagcgcacagcaggtgtttttgccg
ttgggcgcgggggattcccggctgcatcttgtagactcggcggggcaccttgagtttggc
cccgccattaatgttgtgttcccgctcctgcacgggccttttggtgaagacggcacagtt
cagggcctgcttgaaatggcgaacctgccctatgtggggtgcggggtgaccgcctctgcc
gtgggtatggataaacactttatgaaggttgcgtttgctgatgccgggctggaagttggc
ccgtatgaggtggtcacagaccgccagtggcgccatgaccgtgacggggcgctggaacgt
gtggcccggctgggttacccaatgtttgtcaagcctgctcgtgcaggttcgtcgttcggc
atcacgaaggtagacacagctgagcagctggtgcctgcaattgagcaggcgcgcgtgtat
gatccgaaagtggtgattgaggccggtattgtgggccgcgagattgagtgcggtattttg
gatggtcataatggcgatatgccccgcgcatcataccccggcgagattgagatgcagggg
gagcagggaggcttctacgattttgaggccaaatatgtgtcgaagactaccgctgtgacc
cgctgccccgctaacctaccccccgaggatctggagcgtatgcgtcagctggcggtcaag
gcattcttggcgctggatggcgaaggtatctcccgagctgatttcttttacacccccgat
gctcgcctgatcgttaacgaggtgaacaccatgcctgggttcacgccgatctcgatgtat
aagaccatgtgggagaaaaccgggatcgagtacaaggatcttattgatgagttgctgatg
ctggcgctggaacgcccagtaggcctgcggtag

DBGET integrated database retrieval system