KEGG   Rickettsia akari: A1C_00955Help
Entry
A1C_00955         CDS       T00601                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rak  Rickettsia akari
Pathway
rak00020  Citrate cycle (TCA cycle)
rak00190  Oxidative phosphorylation
rak00650  Butanoate metabolism
rak01100  Metabolic pathways
rak01110  Biosynthesis of secondary metabolites
rak01120  Microbial metabolism in diverse environments
rak01130  Biosynthesis of antibiotics
rak01200  Carbon metabolism
Module
rak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rak_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1C_00955 (sdhA)
   00650 Butanoate metabolism
    A1C_00955 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A1C_00955 (sdhA)
Enzymes [BR:rak01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A1C_00955 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     A1C_00955 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABV74521
UniProt: A8GM96
LinkDB All DBs
Position
175325..177115
Genome map
AA seq 596 aa AA seqDB search
MNKAYNIIHHKFDVVVVGAGGAGLRSAFGMAQEGLDTACITKLFPTRSHTVAAQGGISAA
LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTKEGKIYQ
RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLMEDGE
CRGVVAWNLDDGRLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQDM
EFVQFHPTGIYSAGCLITEGARGEGGYLVNVNGERFMERYAPAAKDLASRDVVSRAMTIE
IREGRGVGEHKDHVFLHLNHLSPEILHSRLPGIVETAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSAL
KAAELIKPASPHKPLKEESLEKIINRFDKIRYNNGNILTADLRLKMQRTMQSHASVFRTQ
EVLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKESR
GAHAREDYPGRNDEDWMKHTLSSIDAAGKVVLDYKPVTLTTLTDEISTIPPAKRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagcatataatatcatacatcataaatttgacgtagtagttgtaggtgcaggc
ggagctggtcttcgttctgcatttggtatggctcaagaagggctagacaccgcctgtata
actaagctatttccgactcgtagtcatactgtggctgctcagggcggaatcagtgcagct
cttgggaatatgggcgaagatgattggcgttggcatatgtatgatacagtaaaaggttca
gactggttaggtgatcaggatgccatcgagtatatgtgcaagaatgctcccgatgcgatt
ttagagcttgagcattacggagtacctttttcaagaactaaagagggaaaaatttatcag
cgtccttttggcggtatgacaacagagtacggtaaaggaaaagcggctcagcgtacatgt
gctgcggcagatcgtactgggcatgccatactccatacgttatatcagcagtcactaaag
cataaagtgcagttttttgttgagtattttgctattgatctattgatggaagacggcgaa
tgtagaggcgtagttgcttggaatttagatgatgggagactgcattgttttagagctcat
aatgtagtgcttgcaacgggaggatatgggcgtgcttatttttcagcaacgtctgctcat
acttgtacgggcgacgggggaggtatggcgattagagcaggtttgccgctgcaagatatg
gagtttgtacagttccatccgacaggcatatattcggctggctgtcttattaccgaggga
gctagaggtgaagggggatatcttgttaatgtaaacggagagcgttttatggagcgttac
gctcctgctgcaaaggatttagcttcaagagacgtggtttcaagagcgatgactatcgag
attcgtgaagggcgaggagtcggcgagcataaagatcatgtattcctgcatttaaatcat
ttatcgcctgagattttacatagtcgtttgccaggtattgtggagacggctaaaattttt
gccggtgttgatgtcactaaagagccgataccagtacttcctacagttcattataatatg
ggagggataccgactaattaccacggtcaagtcataatcaaagacggtaaaaatcacaat
agcgtagtaaaaggacttatggcaatcggtgaagcagcttgtgtatcggtacacggtgct
aacaggcttgggtcaaattctttgcttgatttggtggtatttggtagaagctctgcatta
aaagcagctgaacttatcaaaccggcaagtccacataagccattaaaagaagaaagcctt
gagaaaattataaatagatttgataaaattcgttataataacggtaatattttaactgca
gatttaaggcttaaaatgcaaagaactatgcaaagtcacgcttcggtatttagaactcaa
gaggtactagacgaaggagcaggaatgattagtgagataagaagcggctataaagatata
aaaattaacgataaatctttaatttggaatagtgatttagtagaagccttagagctagat
aatctacttgatcaagctttggttacagtatattcggcagctgcaaggaaagaaagcaga
ggagctcatgctagggaagattatcctggtcgtaatgatgaagattggatgaaacatact
cttagttctatcgatgcagcaggtaaagtagttcttgattataaacctgtaacgctaacc
actttaaccgatgagataagtacaattccaccagcaaaaagagtgtattaa

DBGET integrated database retrieval system