KEGG   Rickettsia akari: A1C_04395Help
Entry
A1C_04395         CDS       T00601                                 

Definition
(GenBank) Penicillin-binding protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
rak  Rickettsia akari
Pathway
rak00550  Peptidoglycan biosynthesis
rak01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rak00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A1C_04395
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    A1C_04395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rak01011]
    A1C_04395
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rak03036]
    A1C_04395
Enzymes [BR:rak01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A1C_04395
Peptidoglycan biosynthesis and degradation proteins [BR:rak01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   A1C_04395
Chromosome and associated proteins [BR:rak03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    A1C_04395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer EVI2A
Motif
Other DBs
NCBI-ProteinID: ABV75151
UniProt: A8GP26
LinkDB All DBs
Position
complement(791777..793462)
Genome map
AA seq 561 aa AA seqDB search
MKQILGKWKPAIKSLIIWNVCSKNTKIRLLMVICGFSFLFCTLSYRLIIVATSVYDKNIN
SFKKNHQFRKEIVDRNGNLLAVNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLLS
ELKSNKSFIWVKRDLLPSQQEKITSLGLPGFEFEEEQKRIYTFSNLLSHVVGYVGRDLVG
LSGLELAYDKYLTNSDYELNEPKNRKEPLQLSIDIRLQSILSEEIDKTLKQFKAIGAVGI
IADPNNGEILALVNKPDFDPHHPSLAKPEELFNIASLGIYEMGSVFKALTMAVGFDTGAI
NMNDAYDISYMKVGGFQLKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKSNFKKYLKK
LGLLDQLQIELPERGTPLFPSEKRWNELTSVTMSYGYGISISPLHFVRAMLPVVNGGTLY
DITLLKRKDAKVIGTKVFSENTSTQMKKLFRSVVKEGNGKRAEVKGYLIGGKTGTAEKLS
QGSGGKKKYLKNSRASSFLGVLPASNPQYIIFIRFDEPKPTKESFGFATASWTAAPTAGR
VFERMISLYGLEPIEQSEEES
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaattttaggaaaatggaaacctgcaattaaaagtctgataatttggaacgtt
tgtagtaaaaatacaaaaatccgattattaatggttatttgtggcttttcttttcttttt
tgtactttatcttacagattgataatcgttgctacgagtgtttacgataaaaatattaat
tcctttaaaaaaaatcatcaatttagaaaagaaatagttgatcgaaatggtaatttatta
gcagttaacctaccttctgcctcattatttgctaatccacaaatagttctcgatcctgaa
acttccgtaaaaaaactagcagaaattctacctgatattaataaagctaaattactttct
gaactaaaatcaaataaaagctttatatgggtaaaaagggatttattacctagtcagcag
gaaaaaataactagccttgggttacctggttttgaatttgaagaagagcagaaacgcatt
tatactttttctaatttattgtcgcatgttgtcggttatgtaggtagagatttggtaggg
cttagtggcttagaactcgcttatgataaatatttaactaattccgattatgaattaaac
gaaccaaagaataggaaagaaccgctgcaattatctattgatattagattacaaagtatt
ttaagtgaagagattgataaaactttaaagcaatttaaggccataggagcagtaggaatt
attgcagatccaaataatggcgagattttagcattagtaaataagcctgatttcgatccg
catcatccgagtttagcaaaaccggaagagttgtttaatatagcaagtcttggcatttac
gaaatgggttcggtgtttaaggcattaactatggcagtcggttttgatactggtgcaata
aatatgaatgatgcttatgatataagttatatgaaagtgggaggattccagcttaaggat
tatacgccaaggcaagggtggcatagtgtgcctgagatttttctatattcttcaaatatt
ggcacaagtcaaattatgcttgaaatcggtaaaagcaattttaaaaaataccttaagaaa
ttaggtctattagatcagttacaaatagaattacctgaacgaggtactccgttatttcct
tccgagaaaagatggaatgagttaactagtgttactatgtcgtacggctacggcatttca
attagtcctttgcattttgttagagcaatgttaccggtcgttaacggcggtactttatat
gatattactttattaaaaagaaaggatgcaaaagtaataggtacaaaagtttttagtgaa
aatacctctacccaaatgaagaaattatttaggtcggtagtaaaagaaggtaatggtaaa
agagcagaggtcaaagggtatcttatcggcggtaagaccggtacagcagaaaaactttca
caaggttcaggggggaaaaagaaatatctaaaaaatagtagagcttcatcatttttaggt
gtgctgcccgcatctaacccgcaatatattatttttattagatttgatgagccgaaaccg
actaaagaaagttttggctttgcaacggcaagctggacggctgcccctactgccggtaga
gtgtttgagcgtatgatatctttatatggtttagagccgatagaacaaagtgaggaagag
agttga

DBGET integrated database retrieval system