KEGG   Ruminococcus albus: Rumal_0668Help
Entry
Rumal_0668        CDS       T01387                                 

Definition
(GenBank) Type II site-specific deoxyribonuclease
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
ral  Ruminococcus albus
Brite
KEGG Orthology (KO) [BR:ral00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ral02048]
    Rumal_0668
Enzymes [BR:ral01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     Rumal_0668
Prokaryotic defense system [BR:ral02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    Rumal_0668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII
Motif
Other DBs
NCBI-ProteinID: ADU21214
UniProt: E6UHG9
LinkDB All DBs
Position
761868..762725
Genome map
AA seq 285 aa AA seqDB search
MKRDFNEWLGKFRDSIANYEYYIDFAKVHKNVDSIKVELNILNALIGSKDIENEFMQIVS
KYPETLKCIPLLLAVRANEIYAIDGDGEFSYNFKKMNYSPEQYTVFMRKTGLFELMEKHI
IHSLVDYATGVETGLDSNGRKNRGGHLMEDLVESFIVKAGYIKGQNYFKEMYIHEITEKW
GIDLSAISNQGKAEKRFDFVIKTENMIYGIETNFYASGGSKLNETARSYKQIAQEVDTID
GFTFVWFTDGKGWQSARRNLEETFDVLDTVYSIDDLEKGILKEVL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagattttaacgaatggctcggtaaattcagagacagtatagcgaactatgaa
tactatattgactttgcaaaggtacataaaaacgttgacagcataaaggttgaacttaat
attctgaatgccttaatcggctcaaaggatattgaaaacgagtttatgcagatagtaagc
aagtatcccgaaacgctgaaatgtattcctttgttgcttgctgtcagggcgaatgaaata
tatgcaatagacggtgacggggaattctcttataacttcaagaagatgaactactctccc
gaacagtacactgtatttatgcgtaaaacaggcttgtttgagcttatggagaagcatatt
atccacagcctggtcgattatgcaacaggtgtggaaacaggtcttgattccaacggaaga
aaaaatcgtggcggacatctcatggaagatcttgttgaaagctttattgttaaggccgga
tatatcaagggtcagaattatttcaaggagatgtacattcacgaaataaccgagaaatgg
ggcatcgacctttctgctatatccaatcagggcaaggcggaaaagcgttttgacttcgtt
atcaagaccgaaaatatgatttatggtattgaaacaaacttctatgcaagcggtggttca
aagctgaatgaaactgcaagaagctataaacagatagcacaggaagttgataccattgac
ggatttacgttcgtatggttcaccgacggcaagggctggcagagcgcaagacgtaacctc
gaggaaacgtttgatgtgctggatacggtttattcgattgatgatttagagaaaggaatc
ttaaaagaggtgctataa

DBGET integrated database retrieval system