KEGG   Ruminococcus albus: Rumal_1340Help
Entry
Rumal_1340        CDS       T01387                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
ral  Ruminococcus albus
Pathway
ral00440  Phosphonate and phosphinate metabolism
ral01100  Metabolic pathways
ral01120  Microbial metabolism in diverse environments
ral01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Rumal_1340
Enzymes [BR:ral01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Rumal_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like NTP_transf_3 NTP_transferase
Motif
Other DBs
NCBI-ProteinID: ADU21855
UniProt: E6UET6
LinkDB All DBs
Position
1537649..1539688
Genome map
AA seq 679 aa AA seqDB search
MTLLILDSGRGSRMGGMTDTHPKCMTEISDKETILSRQLSLAASEGLKKVVITTGYLADV
LEDYVRSLDMPLDITFVHNDEFDRTNYMWSIYLARHILDDDIILMHGDLVFDSLVLHEVI
AHEGSCMAVSSSVPLPEKDFKAVIEDGKIVRVGVEFFDNAEAAQPLYKLTKQDFRTWLDN
ITAYCESGIDEKRTCYAEKALNEVSGECDIRPLDVDELLCSEIDNADDLEKVSRKLDSIK
HRNVYMCFSTDIIHNGHISIIKKAAELGRLTVGVLSDEAVAGYKRFPLLPFEERRTMFEN
ISGVDCVVGQQELSYRENIMRLRPDIVVHGDDWRTGVQKPIREETISLLAEYGGRLVEYP
YSYDEKYIGLERRSLAELSTPGIRRSRLKKMLGIKGLITAMEAHSGLTGLIVENTSVCEN
GGIKQFDAMWISSLCDSTARGKPDIELVDMTSRYRTVDEIMEVTAKPIIFDGDTGGIAEH
FVYTVRTLERMGVSMVIIEDKTGLKKNSLFGNEVVQTQADIKDFCAKISAGKRAQKTSDF
MICARIESLILEKGVEDALERAFAYTEAGADAIMIHSRKKDPAEVFEFVERFRAQDADTP
IVVVPTAFDSVTEEEFKARGVNIVIYANQLTRSGFPAMKKAAEMILKNHRAQECDEICMP
FGEIIRLIPDDIKEDNYGR
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgacactgcttatacttgattcgggcaggggttcccgaatgggtggaatgactgatact
caccctaaatgcatgacagagatatcggataaagagactatcctcagccgacagctgtcc
cttgcggcttctgaagggctgaaaaaagtggtcatcactacgggctatcttgccgatgtg
ctggaggactatgtaagaagccttgatatgccccttgatattacgtttgtacacaatgat
gagtttgatagaacaaactatatgtggtcaatatacttagcacgtcatattctcgatgac
gatatcatactcatgcacggcgaccttgtttttgacagccttgttctccatgaagtcata
gcccatgagggcagctgcatggctgtatcctcatctgtacctctgcctgaaaaggacttc
aaggcagttattgaagacggtaagatagtcagggtgggtgtggagttttttgataacgca
gaagctgcacagcccctttataagctgacgaagcaagacttccgcacatggcttgataat
atcacagcctactgcgaaagcggtattgacgaaaagcgcacctgctatgcggagaaagca
ctgaacgaagtttcgggtgaatgtgatatacgtccccttgatgtggatgaactgctttgc
agtgagatagacaatgctgatgatcttgaaaaagtgtcccgaaaactggatagcataaag
cacagaaacgtgtatatgtgcttttcgaccgatataatacataacggtcatatatctata
ataaagaaagctgcagagcttggcaggctcacggtaggtgtgctttcagatgaagcagta
gcaggctacaagcggtttccgctgctgccctttgaggagcgcaggaccatgtttgagaat
ataagcggagtagactgtgtggtgggtcagcaggaactttcgtaccgtgagaatataatg
cggctgcgccccgatatagttgtacacggtgatgactggcgcacaggtgttcagaagccc
atacgtgaggaaacgatctcccttcttgcggagtacggcggcaggctggtggagtatccc
tattcttatgatgaaaaatacatcgggctggagcgccgttctctggcagaactttccact
cccggtataaggcgcagcaggctgaaaaagatgctgggcataaaaggtcttataaccgct
atggaagcccacagcggtcttacggggcttatagttgaaaacacttccgtatgcgagaac
ggcggaataaagcagttcgatgccatgtggataagctccctgtgtgattccaccgcgagg
ggcaagcccgatatcgagctggtggacatgaccagccgttacaggacagttgatgagata
atggaggtcactgccaagcctataatattcgacggtgatacaggcggtatcgcggagcat
tttgtatataccgtccgcacccttgaacgcatgggcgtatcaatggtgataatagaggac
aagaccgggcttaaaaagaacagtcttttcggaaatgaagtcgtgcagacgcaggctgat
ataaaggacttctgtgccaagataagcgccggcaagcgtgcgcagaagacctccgatttt
atgatatgtgcaaggatagaaagtcttatactggaaaaaggtgttgaggacgcgcttgaa
agggcttttgcctataccgaagcaggtgctgatgcaataatgatacacagcagaaagaaa
gaccctgctgaagtttttgagtttgttgaaagattcagggcgcaggacgctgacacacct
atcgttgtagtgcctacggcttttgattctgttacggaggaagaattcaaggcgcgtggc
gtgaacattgtgatatatgcaaatcagcttacgcgaagcggttttcctgccatgaaaaag
gcggcggagatgatactgaaaaatcaccgcgcacaggaatgtgatgaaatatgtatgccc
ttcggtgagataataagactgataccggatgatataaaggaagataattatggacgttaa

DBGET integrated database retrieval system