KEGG   Ruminococcus albus: Rumal_1816Help
Entry
Rumal_1816        CDS       T01387                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ral  Ruminococcus albus
Brite
KEGG Orthology (KO) [BR:ral00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ral01001]
    Rumal_1816
Enzymes [BR:ral01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Rumal_1816
Protein kinases [BR:ral01001]
 Serine/threonine kinases: Other
  Bacterial family
   Rumal_1816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA PBP1_TM APH Kinase-like RIO1 Kdo Seadorna_VP7 Pkinase_fungal FTA2 Haspin_kinase Peptidase_A4 CENP-B_dimeris
Motif
Other DBs
NCBI-ProteinID: ADU22314
UniProt: E6UA92
LinkDB All DBs
Position
2074975..2077185
Genome map
AA seq 736 aa AA seqDB search
MDSNIGKKLDGRYEITELIGVGGMADVYKAQDIMEDRPVAVKILKPEFSGDEEFLRRFRN
ESKAIAVLSHPNIVKIYDVGFTDEIQFIVMEYIDGITLKEFIEQQGVLKWKDALHFITQI
LRALQHAHDKGIVHRDIKPQNIMLFTDGTIKVMDFGIARFSRIDGKTLSDKAIGSVHYIS
PEQAQGEMTDERSDIYSVGVMLYEMLTGRKPFDGDTAVNVALKHMQEVAVPPREIMPSIP
EALEEIVYHAMEKQPAQRYQSAAEMIRDIDTFKLNQSVVFGYKDGSAPVVDNVGFYPVNN
NQSRKPVINDDYDDYDDDYEDDYDDDDYDDDDDDDESGKKRSYVVPILLAVTVAVVIVAA
FIIGWTVIKAFSPKDGSGFGIHTSTITVPNLVGENIIKVEGDFKDKLKIETIEEYNFEYE
KDTIFWQSISPQKSVKEGTTITLKVSKGKQMIVIPDVSGSETEIAESELRAAGFTVVLRS
KYDDKVPDGIAIGTEPVAGTEFASDGAVTLYVSKGPLDTQVKVPNVVGLTKEKAIAILKD
SKLKANVQDMPHDGDKGKVIDQSIEADRRVERDSEITIYVSTGETDPVDLTISLPMPEGM
HGSYSIEVFVNGNVRYNQKINNGESVAGGNVTIDISGKKTETLTVSIRNDETGKSVNYAV
FNVNYDKKTAELNGSLNKDGLIAITPSVKEEPSKPDESSSQADPVPPQPVDPEPPVSDDS
SQADVPPVDNGGENIF
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggattctaatatcggtaagaagctggatggcagatatgaaattaccgagcttataggt
gtaggcggaatggctgatgtctataaggcacaggatattatggaagatcgtcctgtagca
gttaagatccttaaacccgaattttcgggcgatgaggaatttctaagaagattcaggaat
gagagtaaggctattgcagtgttatctcacccgaatatcgttaagatctatgatgtggga
tttactgatgagatacagttcatcgtaatggaatacattgacggtatcaccctgaaggag
tttatcgaacagcagggcgtgctgaaatggaaggatgcactgcattttattacacagata
cttcgtgcgttgcagcacgctcatgacaagggcatcgttcacagggatatcaaaccgcag
aatatcatgctgtttacagacggcacaataaaagtcatggattttggtatcgcaagattc
tccaggatcgatggtaagacactttcggataaggcgatcggttctgtacactatatctct
cctgagcaggctcagggtgaaatgaccgatgaaaggtcggatatctactcagtaggcgtt
atgctttatgagatgctaacaggcagaaagccttttgatggtgatactgctgtgaatgtt
gctcttaaacatatgcaggaggttgcagtacccccgagggagataatgccctccatacct
gaagctcttgaagaaatagtttatcacgctatggaaaagcagccggcacagcgttatcag
tcagctgctgagatgataagggatatagataccttcaaactcaatcagtcagtagttttc
ggctataaagatggttctgctcctgttgtagataatgttggtttttatcccgttaataac
aatcagtcaagaaagccggtcatcaacgatgattatgacgattacgatgatgattatgaa
gatgattacgatgatgacgattatgatgacgacgacgacgatgatgaaagcggtaagaag
aggtcctatgtagttcctatccttcttgctgtaacagttgctgttgttatcgttgcagct
ttcataatcggctggactgttatcaaagccttctcaccaaaggacggttcaggttttggc
attcatacaagtactatcactgtgcctaatttggttggtgaaaacattattaaggtggaa
ggcgattttaaggataaacttaagatcgaaacaattgaagaatacaactttgagtacgaa
aaagataccattttctggcagagtatttcacctcagaagtcagttaaggaaggtactact
attactctgaaggtaagtaagggtaaacagatgatagtcattcctgatgtttccggttct
gaaactgaaattgctgaaagtgagttgagggctgcaggatttacagtagttctcagaagt
aagtatgatgacaaggtccctgacggcatagcgatcggtactgagcctgttgcaggtact
gaatttgcgagcgacggcgctgtaacactttatgtcagcaagggtcctctggatactcag
gtaaaggtacctaatgttgttggtcttactaaggaaaaagcaatcgctatactgaaggat
agcaaacttaaggcaaacgttcaggatatgcctcatgatggtgataagggcaaggtaatc
gatcagtctattgaagctgacagaagagttgagagagattctgagatcacgatctacgtt
tctaccggtgagaccgatcctgttgacctgactatcagtctgccaatgcctgaaggtatg
catggttcctactccatcgaggtatttgtaaacggtaatgtacgctataatcagaaaatc
aacaatggtgaatctgttgcaggtggtaatgttactattgatatctcgggtaaaaagact
gagacacttacagtatctatcagaaacgatgaaacaggcaaatcagttaattatgcagta
ttcaacgtaaactatgataagaagactgctgaactgaatggttcactgaataaggatggt
cttatcgctatcacaccaagtgttaaggaagagccatccaagccggatgagagttcatct
caggcagatcctgtgcctcctcagccagttgatcctgaacctcctgtttctgacgacagc
tcacaggctgatgtaccccccgttgataacggaggcgagaatatattctaa

DBGET integrated database retrieval system