KEGG   Ruminococcus albus: Rumal_2411Help
Entry
Rumal_2411        CDS       T01387                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ral  Ruminococcus albus
Pathway
ral00473  D-Alanine metabolism
ral00550  Peptidoglycan biosynthesis
ral01100  Metabolic pathways
ral01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ral00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Rumal_2411
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rumal_2411
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Rumal_2411
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ral01011]
    Rumal_2411
Enzymes [BR:ral01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Rumal_2411
Peptidoglycan biosynthesis and degradation proteins [BR:ral01011]
 Precursor biosynthesis
  Amino acid ligase
   Rumal_2411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADU22891
UniProt: E6UE26
LinkDB All DBs
Position
2715695..2716780
Genome map
AA seq 361 aa AA seqDB search
MAKLKVAVIFGGRSNEHDVSVVSAAHVIRSISENPDRYEVICIGITKKGHWVRFMGSAED
IANGSWAENPDNVACIFSPDPVHRGFIQLEDDGSYTNIKVDAVFPVLHGKNGEDGTIQGI
FQMAEIPFVGCDLISSACCMDKDVTHTILEAHGVRTAKWISMIYRDISKLDEKCRLMEKE
LGYPMYVKPANCGSSVGITKAHDFEELKAGIKLAFTHDHKVVVEQGINGIELECAVMGND
EPFASTVGEIAAANEFYDYDAKYNNSDSKTYIPARVPDEVIEEIRETAVRAFKAMGCEGL
ARCDFFLSDKGEVILNEINTLPGHTQISMYPKLMEHEGISYAEQEDRLIKLALERSEVDH
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcttaaagtcgctgttattttcggcggcagatcgaatgaacacgatgtctcg
gtagtatccgcggcacacgttatacgctctatcagtgagaatccggaccgttatgaggtc
atctgcataggtataaccaaaaagggtcactgggtaagattcatgggcagtgctgaggat
atagctaacggcagctgggcagagaatcccgacaacgttgcctgcattttcagccccgac
cctgtacaccgcggttttatacagctggaggatgacggcagctacaccaatatcaaggtc
gatgcagtattcccagtgctccacggaaaaaacggagaagacggcactatccagggaata
ttccagatggcagagataccctttgtaggctgtgatcttatttcctcagcctgctgcatg
gacaaggatgttacacatactatccttgaagcacatggtgtgcgcactgccaagtggata
agcatgatctaccgcgatataagcaagctggatgaaaagtgcaggcttatggagaaagag
cttggctatcctatgtacgtaaagcctgcgaactgcggttcttccgtgggtataaccaag
gcacatgactttgaggagctgaaggcaggtatcaagcttgcattcacacatgaccacaag
gtagtagtagaacagggcatcaacggcattgagcttgagtgtgctgttatgggcaacgat
gagccttttgcttcaacagtgggcgagatagcagctgccaacgaattctatgactatgac
gcaaagtacaataattcggactcaaagacctacatacccgcaagagtacccgatgaggtg
atcgaggagattcgtgaaactgcagtacgtgctttcaaggcaatgggctgcgaaggactt
gccagatgcgacttcttcctttccgacaagggtgaggtcatactcaacgagataaataca
cttccgggacacacacagataagtatgtaccccaagctcatggagcatgagggcataagc
tatgccgagcaggaggacagactcatcaagctggcactggaaagatcggaagtggatcat
gaataa

DBGET integrated database retrieval system