KEGG   Rickettsia amblyommatis GAT-30V: MCE_01490Help
Entry
MCE_01490         CDS       T01787                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ram  Rickettsia amblyommatis GAT-30V
Pathway
ram00020  Citrate cycle (TCA cycle)
ram00190  Oxidative phosphorylation
ram00650  Butanoate metabolism
ram01100  Metabolic pathways
ram01110  Biosynthesis of secondary metabolites
ram01120  Microbial metabolism in diverse environments
ram01130  Biosynthesis of antibiotics
ram01200  Carbon metabolism
Module
ram_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ram_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ram_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ram00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCE_01490 (sdhA)
   00650 Butanoate metabolism
    MCE_01490 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MCE_01490 (sdhA)
Enzymes [BR:ram01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MCE_01490 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     MCE_01490 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AFC69307
UniProt: H8K463
LinkDB All DBs
Position
253196..254986
Genome map
AA seq 596 aa AA seqDB search
MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFPTRSHTVAAQGGISAA
LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKKAPDAILELEHYGVPFSRTEEGKIYQ
RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLMEDGE
CRGVVAWNLDDGSLHCFRAHNVVLATGGCGRAYFSATSAHTCTGDGGGMAIRAGLPLQDM
EFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTIE
IREGRGVGEHKDHVFLHLNHLSLEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYHGQVIIKDGKNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSAL
KAAELIKPVSPHKSIKEESLEKIINRFDKVRYANGNILVAELRLKMQRTMQSHVSVFRNQ
EVLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKESR
GAHAREDYPDRNDGDWMKHTLSSIDEAGKVILDYKPVTLTTLTDEVTAVPPVKRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagcgtataatatcattcatcataaatttgacgtagtagttgtaggtgcaggc
ggagcaggtcttcgttctgcattcggtatggctaaagaagggctaaataccgcttgtata
actaagctgttcccaacccgtagtcatactgtggctgctcagggcggaattagtgcggct
cttgggaatatgggcgaagatgattggcgttggcatatgtatgatacggtaaaaggttct
gattggttaggcgatcaggatgccattgagtatatgtgcaaaaaggctcccgatgcgatt
ttagagctagagcattacggcgtacctttctcaagaactgaagagggaaaaatttatcag
cgtccttttggaggaatgacaacagagtacggcaaaggaaaagcagctcagcgtacatgt
gctgcggcagatcgtacggggcatgccatacttcatactttatatcaacagtcactaaaa
cataaagtacagtttttcgttgagtattttgctattgatttattgatggaagatggtgaa
tgtagaggcgtagttgcgtggaatttagatgacggtagtctgcattgttttagagctcat
aatgtagtgcttgcaacgggcggatgcgggcgtgcttatttttcggcgacgtctgctcat
acttgtacgggtgatgggggcggtatggcgattagagccggtcttccactgcaagatatg
gaatttgtacagttccatccgacaggtatatattcggcgggctgtcttattaccgagggg
gcaagaggcgaagggggatatctcgttaatgcaaacggtgagcgtttcatggagcgttat
gctcctgctgcaaaggatttagcttcaagagatgtagtttcaagagcaatgactatagaa
atcagagaggggcgaggagttggcgagcataaagatcatgtatttttacatttaaatcat
ttatcgcttgagattttacatagtcgtttgcccggtatctctgagacggctaaaattttt
gccggtgttgacgtgactaaagagccgataccggtacttcctacggtacattataatatg
ggcgggataccgactaattatcacggtcaagtcataatcaaagacggtaaaaatcataat
agcgtagtaaaagggcttatggcaatcggtgaagcggcttgcgtatcggtacacggtgct
aaccgattaggatcaaattctttgcttgatttagtagtatttggtagaagttctgcatta
aaagcagctgagcttattaagcctgtgagtccccacaagtctataaaagaagaaagcctt
gaaaaaattataaatagatttgataaagtccgttacgctaacggtaatattttagttgca
gagttaaggcttaaaatgcaaagaactatgcaaagccatgtttcggtattcagaaatcaa
gaggtactagatgaaggagcaggaatgattagcgaaataagaagcggctataaagatata
aaaattaacgataaatctttaatttggaatagcgatttagtggaagccttagagctagat
aatctacttgatcaagctttagtaacggtatattcggcagctgcaagaaaagaaagtaga
ggagcgcatgcacgtgaagattatcctgatcgtaatgatggggattggatgaagcatact
cttagctctatcgatgaagcaggtaaagtaattcttgattataaacctgtgactttaact
actttaaccgatgaagtaacagcagtcccgccggtgaagagagtgtactaa

DBGET integrated database retrieval system