KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_1818Help
Entry
Riean_1818        CDS       T01363                                 

Definition
(GenBank) Type II site-specific deoxyribonuclease
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Brite
Enzymes [BR:ran01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     Riean_1818
Prokaryotic defense system [BR:ran02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    Riean_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII TelA DUF2135
Motif
Other DBs
NCBI-ProteinID: ADQ82973
UniProt: E4TDW4
LinkDB All DBs
Position
2007156..2007995
Genome map
AA seq 279 aa AA seqDB search
MSEQFKIFLSQLSETNATLDYFADFKKIRNNVNKIAIKLNQLNYLIGKENLKEAVIELYE
ENSKVFEVLDILIAIRKNKNAKTFNNKGEIVLLDTYFTSPELILEYIEETGLAEVFRNKD
VTNLVDYVFGIEVGLDTNARKNRGGDNMSKAVSLIFDKAGVFYKKEVNNTIFPEIISLGA
DVKRFDFVIKTKKKTYLIETNYYNSGGSKLNETARSYSDVAPKINLYEGYEFVWITDGQG
WFSAKNKLEEAYNIIPSLYNLITLEDFIKKIQEETVIEF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcaatttaaaatctttttatcgcaactttcagaaactaacgcaacgcttgat
tatttcgcagattttaagaaaataaggaacaatgtaaacaaaattgcaatcaaacttaac
caattgaattatttaattggcaaagaaaatttgaaagaagcggtaatagaactttatgaa
gaaaattcaaaagtttttgaagtattggacatcttgattgctattcgcaaaaacaaaaac
gctaaaacattcaacaacaaaggcgaaatagtattgttagacacttatttcacctcgcct
gaactgattttggaatacattgaagaaacgggattggcagaagtttttagaaacaaagat
gttactaatttagttgactatgtttttggaatagaggttggtttagatacaaatgcacga
aaaaacagagggggtgacaatatgtcaaaagctgtttcactcatttttgacaaagcagga
gttttctacaaaaaggaagtaaataatacaatctttccagaaatcataagtttaggtgca
gatgtaaaacgttttgattttgtcattaaaaccaaaaagaaaacttatttaattgaaact
aattattacaatagtggaggttcaaaattaaatgaaacagcaagatcttattctgatgtt
gctcctaaaattaacctatatgaaggttacgaatttgtttggataactgatggacaaggt
tggttttctgcaaaaaacaaattagaagaagcatataacataattccaagtttgtacaat
ttgataacacttgaggattttatcaagaaaatacaagaagaaactgtaatagaattttaa

DBGET integrated database retrieval system