KEGG   Raoultella sp. X13: DSD31_00750Help
Entry
DSD31_00750       CDS       T05540                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
rao  Raoultella sp. X13
Pathway
rao00260  Glycine, serine and threonine metabolism
rao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DSD31_00750
Enzymes [BR:rao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     DSD31_00750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like FAD_oxidored Pyr_redox_3 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AXC28079
LinkDB All DBs
Position
154458..155483
Genome map
AA seq 341 aa AA seqDB search
MKALSKLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMV
VGHEYVGEVVGIGQEVRGFKIGDRVSGEGHITCGHCRNCRAGRTHLCRNTIGVGVNRPGC
FAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA
AVAKHVGARNVVITDVNEYRLGLARKMGVTRAVNVAQESLTDVMAELGMTEGFDVGLEMS
GAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMAA
LIQSGLDLSPIITHRFGIDEFQQGFDAMRSGQSGKVVLSWD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttatccaaactgaaagcggaagaaggcatctggatgaccgacgtaccggaa
ccggaagtcggccataacgatctgctgatcaaaatccgcaagaccgcgatttgcggtacc
gacgtacacatttataactgggatgagtggtcgcaaaaaaccatcccggtgccgatggta
gtagggcatgagtacgtgggtgaagtcgtgggtatcggccaggaagtacgcggctttaag
attggcgatcgcgtttccggcgaagggcatattacctgcggccactgtcgcaactgccgt
gctggccgtacacatctgtgtcgtaacacgatcggcgtaggcgtgaaccgtccgggctgt
ttcgcggaatatctggtcattccggctttcaatgccttcaaaatcccggacaatatttct
gacgatctggcgtcgatttttgacccgtttggcaacgcggtccacacggcgctctcgttc
gatctggttggcgaagatgtactggtatccggcgcaggcccgattgggatcatggcggct
gcggtcgcgaaacacgtcggcgcacgtaatgtggttattactgacgtgaacgaatatcga
ctgggtctggcgcgtaaaatgggcgtgacgcgtgctgtgaatgttgcgcaagagagcctg
accgatgtgatggccgaactggggatgaccgaagggttcgacgtgggcctggaaatgtcc
ggcgcgccgccggcattccgcaccatgctggataccatgaaccacggcggtcgtattgcg
atgctcggtattccgccgtcggatatgtccatcgactggacaaaagttattttcaagggg
ctgtttatcaaagggatttatggccgggaaatgttcgagacctggtacaagatggccgca
ctgatccagtccgggctggatttgtcaccgatcattacccaccgttttggcatcgatgag
ttccagcagggctttgatgcgatgcgctccggccagtccggaaaagtggtgctgagctgg
gattaa

DBGET integrated database retrieval system