KEGG   Raoultella sp. X13: DSD31_01645Help
Entry
DSD31_01645       CDS       T05540                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rao  Raoultella sp. X13
Pathway
rao00250  Alanine, aspartate and glutamate metabolism
rao00410  beta-Alanine metabolism
rao00640  Propanoate metabolism
rao00650  Butanoate metabolism
rao01100  Metabolic pathways
rao01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DSD31_01645
   00650 Butanoate metabolism
    DSD31_01645
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DSD31_01645
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DSD31_01645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rao01007]
    DSD31_01645
Enzymes [BR:rao01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DSD31_01645
Amino acid related enzymes [BR:rao01007]
 Aminotransferase (transaminase)
  Class III
   DSD31_01645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AXC28246
UniProt: A0A2Z5GLG5
LinkDB All DBs
Position
351006..352271
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
IVAAVAQQLEAFTHTAYQIVPYESYVSLAERINALAPVDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNAAHGITTD
EAMKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPAEFMQALRTLCDTHGILLIADEV
QTGFARTGKLFAMQHYDVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEEEQLCQRAEQLGSHLKEVLNQAREYCPAIVDVRGQGSMVAVEFND
PQTGAPSPEFTRHIQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFTKALDILARVLK
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagttcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgcaattactttgttgagaaggcggagaatgccacgctgtgggatgtggaaggtaac
gaggtgattgattttgctgcgggaatcgccgtgctcaataccggccatcgccacccgaaa
attgttgccgccgtcgcgcagcagctggaggcctttacccatacggcgtatcagattgtc
ccttacgaaagctatgtttcgctggcggagcgcattaacgcgctggcgccggtcgatggc
ccggccaaaaccgctttcttcaccaccggtgcggaagccgtggaaaatgcggtgaagatt
gcccgcgcttataccggccgtccggggctgattacttttggcggcggctttcacgggcgt
acctttatgaccatggcgctgaccggtaaagtcgcgccttacaaaatcggttttggaccg
ttccctggttcggtttatcacggggtatacccgaatgctgcccacggcatcaccaccgat
gaggcgatgaaaagccttgagcgtatctttaaagccgatattgccccggaccaggtggcg
gcaattatcctcgagccgattcagggcgaaggcggttttaacgtcgcgccagcggagttt
atgcaggcgctgcgtacgctgtgcgatacccacggcatcctgctgattgccgatgaagtg
cagaccggttttgcccgcaccggcaagctgtttgctatgcagcattacgacgtgaagccg
gacctgatgacgatggcgaaaagccttgccggcggtttcccgctgtcaggcgtagtgggg
cgcgccgaggtgatggatgcgccggcgccgggcggactgggcggcacctatgccggtaac
ccgctggcggtcgccgcggctcatgcggtccttgacgtcattgaagaagagcagctgtgt
caacgtgcggaacagcttggcagccatctgaaagaggtgctgaatcaggcgcgcgagtat
tgtccggcgattgttgatgttcgcggccagggctcaatggttgccgtggaatttaacgat
ccgcagaccggcgcgccgtcaccggagttcacccgccacattcagcaaaaggcgcaggaa
aatggtctgctgctgctgagctgcggcgtctatggcaacgttatccgtttcctgtatccg
ttaactatccccgatgcgcagtttacaaaagcgctggatattctggcgcgcgtcctgaag
ggatga

DBGET integrated database retrieval system