KEGG   Raoultella sp. X13: DSD31_06225Help
Entry
DSD31_06225       CDS       T05540                                 

Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase AroF
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
rao  Raoultella sp. X13
Pathway
rao00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rao01100  Metabolic pathways
rao01110  Biosynthesis of secondary metabolites
rao01130  Biosynthesis of antibiotics
rao01230  Biosynthesis of amino acids
rao02024  Quorum sensing
Module
rao_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DSD31_06225
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DSD31_06225
Enzymes [BR:rao01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     DSD31_06225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AXC29097
LinkDB All DBs
Position
1266606..1267676
Genome map
AA seq 356 aa AA seqDB search
MQKDALNNVHITDEQVLITPDQLKAEFPLSLEQEAQIAQSRQTISDIIAGRDPRLLVVCG
PCSIHDPEAAIEYAHRFKALAEEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDV
EGGLKIARRLLVELVNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGL
SMPVGFKNGTDGSLSTAINAMRAAAMPHRFVGINQAGQVCLLQTQGNPNGHVILRGGKAP
NYGPEDVEKCEKEMAQAGLKPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGL
MIESNIHEGNQSSEQPRCDMKYGVSVTDACISWETTDALLRELDQDLRGHLAARLG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagacgcgctgaataacgtacatattaccgacgaacaggttctgatcacgccg
gatcagctgaaagctgaattcccgctgagcctcgaacaagaagcgcaaatcgcgcagtcc
cgtcagaccatatctgacattattgccggccgcgatccgcgtctgctggtggtgtgtgga
ccttgctcgatccacgatccagaggcggcaattgaatacgctcatcgttttaaagcactt
gccgaagaggtcagcgatagcctctacctggtcatgcgcgtctattttgaaaagcctcgt
actaccgtgggctggaaagggttgattaacgatccgcatatggatggctcgtttgatgtt
gaaggcggtctgaagattgcgcgtcgcttgctggtagagctggttaacatggggttaccg
ctggcaacggaagcgctggatccaaacagcccgcagtacctcggcgatctgtttagctgg
tctgctatcggcgcacgcacgaccgaatcccagactcaccgtgaaatggcgtcaggtctg
tcaatgccggttggctttaaaaacggtaccgacggtagcctgtcgacggcaattaacgcg
atgcgcgccgcggcgatgccgcaccgtttcgtcgggattaaccaggccggccaggtttgt
ctgctgcaaacccagggcaatccgaacggccacgttattctgcgcggcggtaaagcccct
aactacggcccggaagatgtcgagaagtgtgaaaaagagatggctcaggcgggactgaaa
ccgtcactgatggtagattgcagccatgggaattctaataaagactaccgccgccagcct
gcggttgcggaatccgtcgtcgcacagattaaagatggtaatcgttccatcattggcctg
atgatcgaaagtaatatccacgaaggtaatcagtcttctgaacagccgcgttgtgatatg
aaatacggcgtgtccgtcaccgatgcctgcatcagctgggaaacgactgatgccctgctg
cgcgaactggatcaggatctgcgcggtcatctggcggctcgtctggggtaa

DBGET integrated database retrieval system