KEGG   Raoultella sp. X13: DSD31_11470Help
Entry
DSD31_11470       CDS       T05540                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn] SodC2
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rao  Raoultella sp. X13
Brite
Enzymes [BR:rao01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DSD31_11470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AXC30043
LinkDB All DBs
Position
2409227..2409748
Genome map
AA seq 173 aa AA seqDB search
MQRCILAILTLAISAGAQAASENVDLNLVTRQSVGQAIGSVKISETAKGLEFTPDLKALP
PGRHGFHIHANGSCQPAIKEGKAVAAGAAGGHYDPQQTGKHEGPEGRGHLGDLPVLVVNS
DGKATRPVVAPRLKTLDEVRGKALMVHIGGDNMSDSPQPLGGGGERFACGVIK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgatgtatcctcgccatattgactttagcgatctcagcgggcgcgcaggcggcc
agcgaaaacgtggatctcaatcttgttacccgccaaagcgtgggccaggccattggcagc
gttaaaatcagcgagaccgcaaaggggctggaatttaccccagatctcaaagcgctaccg
ccgggtcgacatggttttcacattcatgctaacggtagctgccagccggcgataaaagag
ggtaaagccgtcgctgccggtgccgccggcggacattacgacccgcaacagaccgggaaa
catgaggggcccgaggggcgcgggcatctgggcgacctgccggtactggtagtcaacagc
gacgggaaagccacccggccggtggtggcgccgcggcttaaaacgctggatgaggtacgg
ggaaaagccctgatggtccacattggtggcgacaatatgtccgacagtccgcagcccctt
ggcggaggcggcgaacgttttgcctgcggggtgattaagtag

DBGET integrated database retrieval system