KEGG   Raoultella sp. X13: DSD31_20180Help
Entry
DSD31_20180       CDS       T05540                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
rao  Raoultella sp. X13
Pathway
rao00730  Thiamine metabolism
rao00790  Folate biosynthesis
rao01100  Metabolic pathways
rao02020  Two-component system
Module
rao_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DSD31_20180
   00790 Folate biosynthesis
    DSD31_20180
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DSD31_20180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rao04147]
    DSD31_20180
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rao00537]
    DSD31_20180
Enzymes [BR:rao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     DSD31_20180
Exosome [BR:rao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DSD31_20180
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rao00537]
 Enzymes
  DSD31_20180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase PT-VENN Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AXC32804
LinkDB All DBs
Position
complement(4243072..4244487)
Genome map
AA seq 471 aa AA seqDB search
MKLNALFIALLPLLGSPVIHAETTAAPVLENRAAQGDITTPGGARRLSGDQTAALQASLI
NKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKTGKPDY
VTDSAASATAWTTGVKSYNGALGVDIHEKDHQTILELAKAAGFATGNVSTAELQDATPAA
LVAHVTSRKCYGPSVTSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLHEQAIARGYQIVTDASSLAAVSEANQGKPLLGLFADGNMPVRWEGPKASYHGN
IDKPAITCTPNGKRDASVPTLAQMTEKAIGLLSSNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALEFAKKEGNTLVVVTADHAHASQIIPADSKAPGLTQALTTKDGSVM
VISYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaaacgccctctttattgccctgttacctctgctgggctccccggttattcat
gcagaaaccacggctgccccggttctggaaaatcgtgccgctcagggcgatatcaccacg
cccggcggcgcgcgccgcttaagcggcgatcaaactgccgcgctgcaggcttcgttaatc
aacaaacccgcaaaaaatattattttgctgattggcgacgggatgggcgactctgaaatt
acggcggcgcgcaattatgccgaaggcgccggcggtttctttaagggcattgatgcgctg
ccgctgaccggtcagtacacacattattctctggataagaaaaccggcaaaccggattac
gtcaccgattccgccgcgtccgcgaccgcctggaccaccggcgtaaaaagctataacggc
gcgctgggggttgatatccatgaaaaagatcatcagaccatcctcgaactggcgaaagcc
gcagggtttgccaccggcaatgtctccacggcagagctgcaggatgccacgccagcggcg
ctggtcgcacacgtgacttcgcgtaaatgctatggcccgagcgtcaccagcgaaaaatgt
cccggcaacgcgctggaaaagggcggtaaaggctcaattaccgagcagctgctgaatgcc
cgcgcggacgtgaccttaggcggcggggccaaaactttcgccgaaaccgcgacggccggt
gaatggcagggcaaaacgctgcatgagcaggccattgcccgtggctaccagattgtcacc
gatgccagctcgctggccgcggtcagcgaagccaaccagggcaaaccgctgctgggtctt
ttcgccgacggcaacatgccggtgcgctgggaagggccgaaagcctcttaccacggaaat
attgataagccggcgataacctgcaccccgaacggcaaacgtgacgcttccgttccgacg
ctggcgcagatgaccgagaaagcgatcggtcttctgagcagcaacgagaaaggattcttc
ctgcaggttgagggcgcctccattgataaacaggatcatgcggcgaacccgtgcggtcag
attggcgaaaccgtcgaccttgatgaagcggtacaaaaagcgctggagtttgccaaaaaa
gagggtaacacgctggtcgttgtcaccgctgaccatgcgcacgccagccagattattccg
gccgattccaaagctccgggcctgactcaggcgctgacgaccaaagacggctcggtgatg
gtcattagctacggcaactcggaagaggagtcgatggaacataccggcacgcagctgcgc
attgccgcctacggtccgcatgccgcaaacgtggtgggcttaaccgatcagaccgatctg
ttctacaccatgaaagccgcgctgggtctgaaataa

DBGET integrated database retrieval system