KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_0047Help
Entry
Rahaq2_0047       CDS       T01770                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Brite
Enzymes [BR:raq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Rahaq2_0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEX50001
UniProt: H2J0F2
LinkDB All DBs
Position
complement(50664..51284)
Genome map
AA seq 206 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKETMEIHHTKHHQTYVNNANAALESLPELAALPVEELITK
LDQVPADKKVVLRNNAGGHANHSLFWKGLKTGTTLQGELKSAIERDFGSVDAFKEAFEKA
AATRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAISGASGYPLLGLDVWEHAYYLKYQN
KRPDYIKAFWAVVNWDEAAKRLAEAK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatcactgccttacgcatacgacgcactcgaaccgcatttcgac
aaagaaacgatggaaatccatcacactaaacatcaccagacctacgttaacaatgctaac
gctgcgctggaaagcctgcctgaactggctgcactgccggttgaagaactgatcaccaaa
ctggatcaggttcctgcagacaaaaaagttgtgctgcgtaacaacgcaggcggccacgct
aaccacagcctgttctggaaaggcctgaaaaccggcaccaccctgcagggcgaactgaaa
tctgccatcgaacgcgatttcggcagcgttgacgcgttcaaagaagctttcgagaaagca
gcggcaacccgtttcggttcaggctgggcatggctggtactgaaagatggcaaactggct
gtcgtgtctacggctaaccaggacagcccgctgatgggcgaagccatttccggcgcttcc
ggttacccgctgctgggtctggacgtgtgggaacacgcttactacctgaaatatcagaac
aaacgtcctgactacatcaaagccttctgggccgttgtaaactgggacgaagcagcaaaa
cgtctggctgaagcgaagtaa

DBGET integrated database retrieval system