KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_1815Help
Entry
Rahaq2_1815       CDS       T01770                                 

Definition
(GenBank) ATPase component of various ABC-type transport systems with duplicated ATPase domain
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:raq00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rahaq2_1815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:raq02000]
    Rahaq2_1815
Transporters [BR:raq02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Rahaq2_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_22 oligo_HPY AAA_29 RsgA_GTPase AAA_16 TniB MMR_HSR1 AAA_25 IstB_IS21 AAA_23 AAA_24 NACHT APS_kinase SbcCD_C CbiA DUF2813 DUF87 AAA_18 AAA_15 AAA_33 AAA Mg_chelatase PRK Roc ATPase NB-ARC MobB Sigma54_activat RNA_helicase DLIC Dynamin_N
Motif
Other DBs
NCBI-ProteinID: AEX51683
UniProt: H2IUP0
LinkDB All DBs
Position
complement(1915776..1917419)
Genome map
AA seq 547 aa AA seqDB search
MTRTILEMRGLRIETLDGSPLVQDISLKLAAGEVLGLIGESGAGKSTIGLAALGYARQGC
RIAGGEVFLDGTDIVSQPSHIKRQWRGKRVAYVAQSAAAAFNPALTIEKQVCEGPVRHGL
MSKEESRQWAISLFRSLDLPDPENIGKRYPHQLSGGQLQRAMAAMAMSCKPDLLIMDEPT
TALDVTTQIEVLVMLRKLVREFNTAALYITHDLAVVAQLADRIMVLRHGKEVETGSTQTI
LENPQQEYTRRLVAEREHALTPLTGGHETAGQPLLTMRKLSTGYNGKRVVHDVSLQLPRG
KTLAIIGESGSGKSTLAKALVGLLADTEGTVDFDGMSLSHNFHQRNKETLRRIQMIYQLP
DVALNPRQTLLDIIGRPLTFYFGMSKKQVRGRVEELLRLTELPVKLIDRRPGELSGGQKQ
RVCIARALAAQPELIICDEATSALDPLVAEEVLNLLRRLQEQLGLSYLFITHDLGTVKRI
AHQVAVMYQGQVVASGDTDVVFSAPMHSYTEKLLTSVPEMRTSWLDEVLALRGAALPAAA
ISSTGVL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcacgattttagaaatgcgcgggctgcgcatcgaaaccctcgacggttcgccg
ctggtgcaggatatctctctgaaactggcagccggtgaagtgctcggcctgattggggaa
tccggcgccgggaaatcaaccattggtctggcggcactgggttatgcgcgtcagggatgc
cggattgccgggggtgaagtctttcttgatggcaccgatatcgtctctcagccttcgcac
atcaaacgccaatggcgcggcaaacgcgtggcgtatgtggcacaaagcgcggcggccgcg
tttaatcccgcgctgaccatcgaaaaacaggtctgcgaaggccctgtccgccacggtctg
atgagcaaagaagagagccgtcagtgggcaatatccctgttccgctcactcgatttgccg
gaccctgaaaacatcggcaaacgctatccgcatcagctttccggtggccagcttcagcgt
gcaatggccgcaatggccatgtcctgtaagcctgatttgctgattatggacgagccgact
accgcactggacgtcaccacacagattgaagtgctggtgatgctgcgcaaactggtgcgc
gaattcaataccgccgcgctgtatatcacccacgatctggccgtggtcgcccaacttgcc
gaccggattatggtgctgcgccacggtaaagaagtggaaaccggcagcacgcagaccatt
ctggaaaatccgcagcaggaatatacccgccgactggtagcggagcgtgaacacgcactg
acgccgctgaccggcggccatgaaacggccggtcagccattgctgacgatgcgcaaactc
agcactggctacaatggtaagcgggtggtacatgacgtcagtctgcaactgccgcgtggc
aaaacgctggcgattatcggcgaatccggcagcggcaaaagtacgctggcaaaggcgctc
gttggcttgctggcggacaccgaaggcacggtagatttcgacggcatgtcgctttcgcat
aatttccatcagcgcaataaagaaacgctgcgccgcatacagatgatttatcagttgcct
gacgtggcgctcaatccgcgccagaccttgctggatatcatcggccgcccgctgacattc
tatttcggcatgagcaaaaagcaggtacgcgggcgcgtggaagaattactgcgactcacc
gaactgccagtcaaactgatcgaccgtcgccccggcgaactttccggcgggcagaagcag
cgcgtttgtatcgcccgcgcgctggccgcgcagccggaactgattatctgcgatgaagcc
acgtcggcactcgatccgctggtggcagaagaagtgctgaatctgctgcgtcgcttacag
gaacagctcgggctgtcgtatctgtttatcacccacgatctgggcacggtaaaacgtatc
gcccaccaggtggcggtgatgtatcagggtcaggtcgtcgccagcggtgataccgacgta
gtcttcagcgcgccaatgcacagttacaccgaaaaactgctgacctccgtaccggaaatg
cgcacaagctggctggacgaggttctcgccctgcgcggcgcggcgcttcctgcggcagcc
atttcttcgacaggagtcttatga

DBGET integrated database retrieval system