KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_2796Help
Entry
Rahaq2_2796       CDS       T01770                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rahaq2_2796
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:raq02000]
    Rahaq2_2796
Enzymes [BR:raq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Rahaq2_2796
Transporters [BR:raq02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rahaq2_2796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_2 GST_N_3 GST_C_3 GST_C_2 Tom37 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AEX52629
UniProt: H2ISI1
LinkDB All DBs
Position
3013773..3014378
Genome map
AA seq 201 aa AA seqDB search
MKLYYKAGACSLSPHIVLREAGLDFSIEKVDLATKKTETGDDFLAVNPKGQIPTLLLNDG
SILTEGVAIVQYLADQKPDRQLMPEQGTPARYHALEWLNYIATELHKGFSPLFNPKAPEE
FKALTREALSKKFAYVNESLKGNHFLLGARFSVADAYLFTVMGWAKALKFDLTALTELNA
YLDRVAARPAVDAALSAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtattataaagccggtgcctgttccctttcccctcatatcgttctgcgtgaa
gcgggtctggatttcagcattgagaaggttgatctggcgactaagaaaaccgaaaccggt
gatgacttcctcgcagtcaatccaaaggggcagatccccacgctgttgctcaatgatggc
agtattctgaccgaaggcgtggctatcgtgcagtatctggctgaccagaaacctgaccgc
cagctgatgccggagcagggaacaccagcccgttatcacgcactggaatggctgaactac
attgcgactgagctgcacaaaggtttctcgccgttgttcaatccaaaagcaccggaagag
tttaaggcgctgacccgtgaagcactgagcaagaaatttgcttacgtgaatgagtctctg
aaaggcaatcacttcctgctgggtgcccgtttcagcgtcgcggatgcctatctgttcacg
gtaatgggttgggcgaaggcgctgaagtttgacctgactgcgctgacggaactgaacgcc
tatctcgaccgcgtggccgcacgtccggccgttgatgctgcgctgtcagctgaaggcctg
aaataa

DBGET integrated database retrieval system