KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_3542
Entry
Rahaq2_3542       CDS       T01770                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00052  Galactose metabolism
raq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Rahaq2_3542
Enzymes [BR:raq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     Rahaq2_3542
SSDB
Motif
Pfam: ADH_N ADH_zinc_N TrkA_N AlaDh_PNT_C Glu_dehyd_C 2-Hacid_dh_C Methyltransf_25 Shikimate_DH 3HCDH_N UDPG_MGDP_dh_N PrmA Pyr_redox_2 ELFV_dehydrog MTS AAA_27 CoA_binding Methyltransf_24 Methyltransf_31 XdhC_C ThiF PALP GFO_IDH_MocA NAD_binding_7 Met_10 Pyr_redox DUF4784 ADH_N_2
Other DBs
NCBI-ProteinID: AEX53339
UniProt: H2J096
LinkDB
Position
3753194..3754243
AA seq 349 aa
MKSVVVHADSKITIEEQPAPTLSAPDEVLVRIAYSGLCGSDIPRIFASSSHFYPITLGHE
FSGHVVNTGEEVSDLHEGDAVACVPLLPCFQCEECRKTAYSQCKHYQFIGSRRSGGHAEF
IVVSRKNLFKLPENFSLLQGAFLEPLTVGLHALKLAGGCEGKEVIVVGAGTIGQLLIQAA
SALGAKSVTAIDINPQRLALARETGASHVYNSAMSDADEIRQQTHERRFNQLIVETAGTA
QTVALSLNIAGPKAQIALVGTLHKDLTLDVATFGHILRKELTLLGSWMNYSSPWPGNEWR
QAVQLFAENKLSLDPLIASVARPQEFVRHVTALAGKPMTGKILLDMTGG
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaatctgtcgttgtacatgctgacagtaagataacgattgaagagcaacccgctccc
acgctgagtgctcctgatgaggtactggtgcgcattgcctactccgggctttgcggatcc
gatatcccgcgtattttcgccagcagttcacatttttatcccatcacattgggccatgaa
tttagtggccacgtcgtcaacaccggagaagaagtcagcgatttacacgagggggatgcc
gtggcctgcgtacctttactgccgtgttttcagtgcgaagaatgccgcaaaacggcgtat
tcccaatgtaagcattatcagtttataggctcccgccggagtggcggccatgctgaattt
attgtggtttcacggaaaaacttgttcaaattgccggagaatttttcactgctgcagggc
gcttttttggaaccgctcaccgttggcttgcatgcccttaaactggcaggaggttgtgaa
ggtaaagaggtgatagtggttggagctggcaccatcgggcagttgcttattcaggcagcc
agcgcactgggggctaaatcggtgacagccattgatatcaatccgcagcgccttgccctg
gcacgggaaacaggtgccagccacgtttataacagcgcaatgtccgatgccgatgaaatc
cgccagcaaacacacgaaaggcgctttaatcagctgattgttgaaacggcaggcacggct
caaaccgtggcactgtctcttaatatcgcaggcccaaaagcgcaaatcgcgctggttggt
accttacacaaagacctgactttagacgtcgccactttcggtcatatcctgcgcaaagaa
ctgaccttgctcggcagttggatgaattattcctctccgtggccgggcaatgagtggcga
caggccgttcagctttttgctgagaacaagctaagccttgaccctctgatcgccagcgtt
gcccgtccgcaggagtttgtcaggcacgttacggcactggctggcaagccgatgacggga
aagattctgctggatatgacgggaggctga

DBGET integrated database retrieval system