KEGG   Rahnella aquatilis CIP 78.65 = ATCC 33071: Rahaq2_4710Help
Entry
Rahaq2_4710       CDS       T01770                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
raq  Rahnella aquatilis CIP 78.65 = ATCC 33071
Pathway
raq00250  Alanine, aspartate and glutamate metabolism
raq00410  beta-Alanine metabolism
raq00640  Propanoate metabolism
raq00650  Butanoate metabolism
raq01100  Metabolic pathways
raq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:raq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Rahaq2_4710
   00650 Butanoate metabolism
    Rahaq2_4710
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rahaq2_4710
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rahaq2_4710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:raq01007]
    Rahaq2_4710
Enzymes [BR:raq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Rahaq2_4710
Amino acid related enzymes [BR:raq01007]
 Aminotransferase (transaminase)
  Class III
   Rahaq2_4710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEX54434
UniProt: H2J1I7
LinkDB All DBs
Position
pRahaq201:147601..148869
Genome map
AA seq 422 aa AA seqDB search
MSHSELEKRRKEATPRGVGVMCDFYAAKAENATLWDEQGREYIDFTAGIAVLNTGHRHPK
IVEAIRNQLDLFTHTSYQIVPYASFVDLAERINMISPVSGKAKTTFFSTGAEAVENAVKI
ARSATGRPGIITFSGAFHGRTLLTMALTGKVVPYKVGFGPFPASVFHAQYPNAVHGVTTE
MALDSIERIFRSDIAPQQIAAILYEPVQGEGGFNIAPEDFVKGLREICDRHGIVMIADEV
QSGFARTGKMFASEYYPDAKPDIVTMAKSLGGGLPISGVTGRAELMDAPEPGGLGGTYAG
NPLAVASALAVLDIIEEEKLCERANRLGAELAEVLEKAKANCAALVDVRARGSMVAAEFN
DPSTGKPSSELTRQYLRKALDAGLLMLSCGVHGNVIRFLYPLTIPDVQFKAALTILSRVL
AD
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacagtgaactggaaaaacgccgtaaagaggcgacaccgcgtggtgttggcgtc
atgtgtgatttctatgcagcgaaagcagaaaatgccacgctgtgggatgagcaagggcgg
gagtatattgatttcactgccgggattgcggtactgaacaccgggcatcgtcacccgaaa
atcgttgaagccatccgcaaccagctcgacctgttcacgcacacttcctaccagattgtg
ccttatgccagctttgtggatctggccgaacgcatcaacatgatttcaccggtgagcggc
aaagcgaaaaccacgttcttcagtaccggcgcggaagctgtcgaaaacgcggtgaaaatt
gcccgctccgccaccggtcgtcccggcatcatcaccttctccggcgcctttcatggccgc
acgctgctgaccatggcgctgaccggcaaagtggtgccttacaaagtgggcttcgggccg
ttcccggcctcggtctttcacgcgcaatatcccaacgctgttcacggcgtcaccactgaa
atggcactcgacagcatcgagcgtattttccgcagcgatatcgcgccgcagcagattgct
gcgatcctgtatgagccggtacaaggcgagggcggctttaatattgccccggaagatttc
gtgaaaggtctgcgcgaaatctgtgaccgtcacggcatcgtgatgattgccgacgaagta
cagagcgggtttgcgcgcaccggtaaaatgtttgcctcagagtactatccggatgccaaa
ccggacatcgtcactatggcgaaaagtctcggcggcggtttgccgatctccggggtcacc
gggcgtgctgaactgatggatgcaccggagccgggtggccttggcggcacgtacgcgggt
aatccgctggctgtcgcttctgcgctggcggtgctggacatcattgaagaagaaaaactc
tgcgagcgcgcaaatcgtctgggcgcagagctggccgaagtgctggagaaagccaaagcg
aattgcgcggcgctggtggatgtccgcgcgcggggatcgatggtggcggctgaatttaac
gatccgtctaccggaaagccttcttctgaactgaccaggcagtatctgcgcaaagcactg
gacgccggattgctgatgctcagttgcggtgtacacggcaacgtgatccgtttcctgtat
ccgctgaccattcctgatgtgcagttcaaagctgcactgaccattttgtcccgcgtgctg
gctgactga

DBGET integrated database retrieval system