KEGG   Riemerella anatipestifer RA-GD: RIA_1864Help
Entry
RIA_1864          CDS       T02007                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
rar00020  Citrate cycle (TCA cycle)
rar00310  Lysine degradation
rar00380  Tryptophan metabolism
rar01100  Metabolic pathways
rar01110  Biosynthesis of secondary metabolites
rar01120  Microbial metabolism in diverse environments
rar01130  Biosynthesis of antibiotics
rar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RIA_1864
  09105 Amino acid metabolism
   00310 Lysine degradation
    RIA_1864
   00380 Tryptophan metabolism
    RIA_1864
Enzymes [BR:rar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     RIA_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N HTH_22
Motif
Other DBs
NCBI-ProteinID: ADZ12924
LinkDB All DBs
Position
1858388..1861147
Genome map
AA seq 919 aa AA seqDB search
MDKFSFLNATHADFIDSMYQQYLKYPDSLEPSWKAFFQGFDFALENFGEDDSFTEKVGAS
SLSQQVGVPDDIIKEFKVLNLIEAYRTRGHLFTRTNPVRERRTYLPDLSIENFGLSKSDL
DTKFNSATETGMLGAATLADIIRHLDQIYCDSIGIEYMHIREVEEKEFIRQWISKNENHP
ELSADEKIQILSKLNQAVAFENYLHTKFVGQKRFSLEGGESLIPALDQLISRSSKHGVDE
VVLGMAHRGRLNVLTNIFGKSYKQIFSEFEGKEFEEDVFSGDVKYHLGSTTKIKTAAGEE
VIINLTPNPSHLETVASLVQGISRAKIDHTYGNNFKKVLPIVIHGDAAIAGQGIVYEIAQ
MMTLDGYKTGGTVHIVVNNQVGFTTNYLDARSSTYCTDIAKVTDSPVMHVNADDVEAVVH
AIRFAADYRAAFGKDVYIDLLGYRKYGHNEGDEPRFTQPKLYNTIAKHPNPREIYKVKLE
KEGVLSEGVLKKMEEEFKTLLDKDFDASKEIQKNTLDVFMEQVWIKYLDPANKQKVLKAV
ETQYNAEQLKELAVKMSSLPKDKAFIRKITRLFEQRLKMIEEDKLDWAMAELLAYATLLA
EGYNVRISGEDVERGTFSHRHAVVKTEDAEEEYVPLQHINESQQFHIYNSLLSEYAVLGF
DYGYAMASPDTLTIWEAQFGDFVNGAQIIVDQYLVAAEEKWKLQNGLVMLLPHGSEGQGA
EHSSARLERFLTLCANNNIFVANCTVPANYFHLLRRQMKFPFRKPLVVMTPKSLLRHPKV
ISSMEELANGSFQPVIDDATADASKVERLVMCSGKVYYDLLAKKEELGDEKVALVRLEQL
YPLDSEKIETVLSKYSNRKDFVWVQEEPENMGAWSYILRNFRKYDVQVIAPVPSGTPAPG
SHKKYEINQTNVINQTFGI
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggataaattttcattcttaaatgcaacacatgctgatttcatagatagcatgtaccag
cagtacttaaaatacccagatagtttagagccatcttggaaagctttttttcaagggttt
gattttgctctagaaaattttggtgaagacgattcttttacagaaaaagtaggtgcgtct
tctttatctcagcaagtaggtgtcccagatgatattataaaggagtttaaagttcttaac
ttaatagaggcttatagaactagaggtcatttgtttactagaactaaccctgttagagag
agaagaacttatctccctgatttatctatagagaattttggattatcaaagtcagattta
gatactaaatttaactctgctacagaaacaggaatgctgggagctgctactttggcagac
attattcgtcatttagaccaaatttattgcgactctatcggtatagaatatatgcatatt
cgtgaggtggaggagaaggaatttattcgccagtggatttctaagaatgaaaatcaccca
gaactttcggcagacgaaaaaatacagattttatctaagctcaatcaagcggtagcattt
gaaaactatcttcatactaaattcgtaggacaaaagagattttcactggaaggaggagag
tctttaatccctgctttagaccagcttattagtcgttcttcaaaacatggtgtagatgaa
gtggttttgggtatggcacacagagggaggcttaatgtattaactaatatctttgggaaa
tcatacaagcaaatcttctctgaatttgaaggtaaagaatttgaggaagatgtattttct
ggagatgttaagtatcacttaggttctactacgaaaataaaaacggctgcaggagaagag
gtaattatcaatttaacgcctaacccgtctcacttagaaactgtagcttctttagtacaa
ggtatttctagagctaaaatagaccatacttacggtaataattttaaaaaagtattaccg
attgttatccatggagatgcagctattgcaggacaaggaattgtctacgagattgcacaa
atgatgactttagacggctacaagacaggaggaacggttcatattgtagttaataatcag
gtaggatttacaaccaactatctagatgcgaggtcttctacttattgtacggatattgct
aaggtaacagactcgcctgtgatgcatgtaaatgcagatgatgtagaggctgtggtacat
gcaattagatttgcggcagattatagagcagcgtttggcaaagatgtttatatagatttg
ttaggatacagaaagtacggacataacgaaggtgatgagcctcgttttacgcagcctaaa
ctttataataccattgcgaaacaccctaatcctagagaaatatataaagtaaaactagag
aaagaaggagtgctttctgaaggagtgttgaagaagatggaggaagaatttaaaaccctt
cttgataaagattttgatgcatctaaagaaattcaaaaaaatactttagatgtatttatg
gaacaggtttggattaagtatctagaccctgcaaataaacaaaaagttctaaaggctgta
gaaactcaatacaatgctgaacagttaaaagagttggcagttaagatgtcttctttacct
aaagacaaggcgttcataagaaaaatcactagactttttgaacaaaggctaaaaatgata
gaagaggataagttagattgggcaatggcagaacttttagcttatgctacgcttcttgca
gaagggtacaatgtgagaatttctggggaagatgtggagagaggtactttctctcaccgt
catgcagtggtaaaaacagaagatgcagaggaggaatatgtaccattacaacatatcaac
gaaagtcagcagtttcatatttataactcattactatcagagtacgctgttttagggttt
gattatggttatgctatggcatcgcctgatactttaaccatttgggaagcacagtttgga
gatttcgtgaatggcgctcaaattattgtggaccaatatttggtagctgcagaagaaaaa
tggaagctgcaaaatggtttggtaatgttgttacctcacggctctgaagggcaaggtgca
gaacactcttcggctaggttagagagatttttaacgctttgtgctaataataatattttc
gtagctaactgtacagttccagccaattatttccatttattgagaaggcaaatgaagttt
ccgtttagaaaaccgttagtggtaatgacacctaagtcgttactaagacaccctaaggtt
atttcttctatggaagagttagcaaacggaagtttccaaccagtgattgatgatgctacg
gctgatgcttctaaggtggagagattagtgatgtgttctggtaaggtttactacgattta
ttggctaaaaaagaggaattgggagatgagaaagtagctttagtaaggctggagcagtta
tatcctttggattcagagaaaatagagactgtgttgtctaaatattctaacagaaaagat
tttgtatgggttcaagaagagccagagaatatgggagcttggtcttatattttgagaaat
ttccgcaagtatgatgtacaagtaattgcaccagttcctagtggaacgccagcaccaggt
agccataagaagtatgagattaaccaaactaatgtaattaaccaaacatttggtatctag

DBGET integrated database retrieval system