KEGG   Riemerella anatipestifer RA-GD: RIA_1953Help
Entry
RIA_1953          CDS       T02007                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rar  Riemerella anatipestifer RA-GD
Pathway
rar00620  Pyruvate metabolism
rar00680  Methane metabolism
rar01100  Metabolic pathways
rar01120  Microbial metabolism in diverse environments
rar01200  Carbon metabolism
Module
rar_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RIA_1953
  09102 Energy metabolism
   00680 Methane metabolism
    RIA_1953
Enzymes [BR:rar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RIA_1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADZ13005
LinkDB All DBs
Position
complement(1951839..1954394)
Genome map
AA seq 851 aa AA seqDB search
MEDRKTKLERFEESVLSKYQIYNSIFMTLPFSGVSNVGRFLPLFGEECKKGYQDNKTPTE
IVEEFFKKYAPQSSEKETNDLLFRFIQYIERQVVLFDAIEDAAFSTVNNMDGLGSIRNMK
EKAEARNKVTELKATLQKLKVRPVLTAHPTQFYPDSVLVIINDLTQAIKDNDLTTIKKLL
AQLGKTPFYKKEKPSPLDEAIGLIWYLENVFYHSMGNIYSYLKKHILKDEALKNPVVELG
FWPGGDRDGNPFVKPETTLKVAERLKKSILKNYYKDIRVLKRRLTFKGVEHLVKNLEDQL
YKAAFLEEENTLTLQEFRQSLEEIRAILISEHQSLFVDELDALLYKVDIFGFYFASLDIR
QDSRIHRIVIEDIAKSTSGKIIPENYSSLSCEEQIQVLSQVNGVLDLTSFNQEITKDTLG
SILMMMAIQKENGEKGCNRYIISNNQNAANVLEVYTLLKLCGWQNPTVDIVPLFETIDDL
DNAEEVMTTLYQNKDYKEHLKSRGYQQTIMLGFSDGTKDGGYLKANWSIYTAKERLTKIS
REYGIEVLFFDGRGGPPARGGGKSHQFYASFGKDIESDAIQITIQGQTISSNFGTLDSSQ
YNLEQLISAGVNNKIFTSEQASISSEEKEILQDLADISYQKYTEFKNHPKFIPYLEKMST
LKYYAKANIGSRPSKRGNSDTLNFSDLRAIPFVGSWSQLKQNVPGFYGVGTALAHYDANG
NFEKLKALYKKSLFFRTLLENSMMSLTKSFFKLTEYMKDDVEFGAFWQEIYQEYQLSKEM
LLKLTEFKSLMEDHPAGKASIQIREEMVLPLLTIQQYALKKVQDGSPLSEVYENMVVRSL
FGNINASRNSA
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggaggatagaaaaacaaaactagagcgttttgaagaaagtgtgttatctaaatatcag
atttacaacagtatttttatgacattacctttcagtggtgtgtctaatgtggggagattt
ttgcctctgtttggcgaagaatgtaaaaaaggctatcaagataataaaacacctaccgaa
atcgtagaagagtttttcaaaaaatacgctccacaatcctccgaaaaagaaactaacgac
cttctgtttaggtttatacaatatattgaaaggcaagtagttttatttgatgccatagaa
gatgccgccttttccacagtaaataatatggacggactgggcagtatccgaaatatgaaa
gagaaagccgaagctcgtaacaaggttactgaacttaaagctactctacaaaaacttaaa
gtaagacctgtacttactgctcacccaactcaattctatccagactctgtattggttatc
attaacgatttaacccaagcgattaaagataatgacttaaccaccatcaaaaaacttcta
gcacagctaggtaaaacgcctttctataaaaaggaaaaaccaagtccgttagatgaagct
attgggcttatttggtatttagaaaatgtattttaccattctatggggaatatttacagc
tatcttaaaaaacatattttgaaagatgaagctcttaaaaaccccgtggtagaactaggc
ttttggcccggaggcgatagagatggtaacccttttgtaaaaccagaaaccactctaaaa
gtagcagagagactcaaaaaaagtattctaaaaaactactataaagacatcagagtccta
aaaagaagactcacttttaaaggagtggaacatttagtaaaaaatctagaagaccaactc
tataaagcagcatttttagaagaagaaaacactctaacgcttcaagagttcagacaatct
cttgaagaaatacgagccattttaatctcagaacatcaatctctatttgtagatgagcta
gatgctttactctataaagttgatatctttggattctattttgcaagtctagacatcaga
caagattctagaatccatcgaattgtgatagaagatattgcaaaatctacctctggaaaa
attattcccgagaactattcaagcctttcctgtgaagaacaaatccaagttttatcacaa
gtaaatggtgtgttagacctaacctcatttaaccaagaaatcactaaagataccttaggt
tctatcctaatgatgatggctatccaaaaagaaaatggagaaaaaggttgcaacaggtat
attattagtaataatcaaaacgcagctaatgtactagaggtatataccttactgaagctt
tgtggttggcagaaccctaccgtagatattgtaccactttttgagaccatagatgatttg
gacaatgccgaagaggtaatgacaacgctttaccaaaataaagattacaaagaacacctt
aaatctagaggctatcaacaaaccattatgctcggtttttctgacggaactaaagacggt
ggctatctaaaagccaactggagcatctataccgctaaagaaagacttaccaaaatctct
agagaatatggtatagaagttctgttttttgatgggcgtggtggacctccagctagaggt
ggtggcaaatctcaccagttctatgcttcttttggtaaagatatagagtctgacgctata
caaattacaatacaagggcaaaccattagctctaactttgggactttagactcttcacag
tataatttagaacagcttattagtgctggtgttaataataaaattttcactagtgaacaa
gctagtatttcttctgaagagaaagaaattttacaagatttagcagacattagctatcaa
aaatatacggaatttaaaaatcatcctaagtttatcccgtacctcgaaaagatgagtacg
ctaaagtattatgctaaagccaatataggaagtaggccttccaaaagaggtaattcagat
acactcaactttagtgatttaagagccattccgtttgtgggtagctggagccaactaaaa
caaaatgtacctggtttttatggtgtgggtactgctttggctcattatgatgctaatgga
aattttgaaaaactaaaggcactatataaaaaatctctatttttcagaactttactagaa
aatagtatgatgagccttaccaaatctttctttaaactcacggagtatatgaaagacgat
gtggaatttggtgctttttggcaagaaatttatcaagaataccaactttctaaagaaatg
ctcctaaaacttacagagtttaaaagccttatggaagaccacccagctggtaaagcctct
atacagataagagaagaaatggttttacctctacttaccatacagcaatatgctctaaaa
aaagtgcaagacggaagtcctctttctgaagtttatgaaaatatggtggtaaggtctcta
tttggaaacattaatgcgagtagaaattctgcgtag

DBGET integrated database retrieval system