KEGG   Riemerella anatipestifer CH3: M949_0441Help
Entry
M949_0441         CDS       T03250                                 

Definition
(GenBank) type ii site-specific deoxyribonuclease
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
rat  Riemerella anatipestifer CH3
Brite
Enzymes [BR:rat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     M949_0441
Prokaryotic defense system [BR:rat02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    M949_0441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII TelA DUF2135
Motif
Other DBs
NCBI-ProteinID: AIH01612
LinkDB All DBs
Position
complement(433266..434105)
Genome map
AA seq 279 aa AA seqDB search
MSEQFKIFLSQLSETNATLDYFADFKKIRNNVNKIAIKLNQLNYLIGKENLKEAVIELYE
ENSKVFEVLDILIAIRKNKNAKTFNNKGEIVLLDTYFTSPELILEYIEETGLAEVFRNKD
VTNLVDYVFGIEVGLDTNARKNRGGDNMSKAVSLIFDKAGVFYKKEVNNTIFPEIISLGA
DVKRFDFVIKTKKKTYLIETNYYNSGGSKLNETARSYSDVAPKINLYEGYEFVWITDGQG
WFSAKNKLEEAYNIIPSLYNLITLEDFIKKIQEETVIEF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcaatttaaaatctttttatcgcaactttcagaaactaacgcaacgcttgat
tatttcgcagattttaagaaaataaggaacaatgtaaacaaaattgcaatcaaacttaac
caattgaattatttaattggcaaagaaaatttgaaagaagcggtaatagaactttatgaa
gaaaattcaaaagtttttgaagtgttggacatcttgattgctattcgcaaaaacaaaaac
gctaaaacattcaacaacaaaggcgaaatagtattgttagacacttatttcacctcgcct
gaactgattttggaatatattgaagaaacgggattggcagaagtttttagaaacaaagat
gttactaatttagttgactatgtttttggaatagaggttggtttagatacaaatgcacga
aaaaacagagggggtgacaatatgtcaaaagctgtttcactcatttttgacaaagcagga
gttttctacaaaaaggaagtaaataatacaatctttccagaaatcataagtttaggtgca
gatgtgaaacgttttgattttgtcattaaaaccaaaaagaaaacttatttaattgaaact
aattattacaatagtggaggttcaaaattaaatgaaacagcaagatcttattctgatgtt
gctcctaaaattaacctatatgaaggttacgaatttgtttggataactgatggacaaggt
tggttttctgcaaaaaacaaattagaagaagcatataacataattccaagtttgtacaat
ttgataacacttgaggattttatcaagaaaattcaagaagaaactgtaatagaattttaa

DBGET integrated database retrieval system