KEGG   Rickettsia australis: MC5_03665Help
Entry
MC5_03665         CDS       T01783                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
rau  Rickettsia australis
Pathway
rau00550  Peptidoglycan biosynthesis
rau01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rau00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MC5_03665
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    MC5_03665
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rau01011]
    MC5_03665
Enzymes [BR:rau01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MC5_03665
Peptidoglycan biosynthesis and degradation proteins [BR:rau01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   MC5_03665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AFC71059
UniProt: H8K716
LinkDB All DBs
Position
642005..643789
Genome map
AA seq 594 aa AA seqDB search
MLNKKILHGELISRRAFIIGLGKLGFLSLLGIRMFYLQLIKSEEYKTLSDKNRINFVVLL
PTRGRIYDLDGSILATNKPCYQLVIDRSINNNYWDELEIISNILNLSPEKYNYIKQKIKK
SSRHTPLIILDQLDWQQVSMIEEQKHKLASIFIYIGYLRFYPFSSTTSHLIGYLGQINEQ
EKQELNIHSLSDFNIGKSGIEKYYDNKLRGEFGYKKVEVNAYGKQVREIAGTPTKSGEDM
YLNIDASLQQNIQQYLNPKGSSAIVMDTRTGNILICASTPGFESNNFSKLSENYWQSLMS
DPYKPLINKVIQSSYPPGSVFKIITVLAALEVGINPNKTVFCDGSSALGTNSFRCWNHSG
HGTVDMMSALKYSCNIYMYELAKIVGPDKILEVAREFGLGSKTGIDLAPESSGFVPSKEW
KKKKLQLPWSIGDSFNLAIGQGFLGVTPMQLARFITAIASNGKLYTPRILKNDSEFYNVN
IKPENIKIIQESLYNTVNVAGGTAYYNRILGKNRQLAGKTGTSQVQGKLNAKDDLNRDSI
AWERRNHALFLGFAPYHDPRYSVTVFVDHGGGGSKAAAPIARKIMSDVLDKYTR
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgctaaataaaaaaatactacatggtgagttaatttcacgaagggcctttataatcggg
ttaggtaaactcggatttttatcactgcttggaataagaatgttttatttgcagcttatt
aaaagtgaagaatataagactttatcagataagaatcgtattaattttgttgtacttctg
ccgaccagaggaagaatttatgatttagatggcagtatcttagctactaataaaccatgt
tatcagctagtaatagataggagcattaataataattattgggatgaattagaaataatt
agtaatattctaaatttatctccggaaaaatataattatattaagcaaaaaattaaaaaa
tctagtcgccacactcctttaataatacttgatcagcttgattggcagcaagtatcaatg
attgaagaacaaaagcataaactggcttcaatattcatttatataggatatttaaggttt
tatcctttttcaagcactacttctcatttaatcggttatctaggtcaaataaatgaacaa
gagaagcaagagttaaatatacatagcttaagcgattttaatattggtaaatccggtatc
gaaaaatattacgataataaattacgaggagaattcggttataaaaaagttgaagtaaac
gcttacggtaagcaggtaagagaaatagcaggaacccctactaaatctggtgaagatatg
tatttaaatatcgacgcttctcttcagcaaaatatccagcaatatttaaatcctaaaggt
tcttcggcaatagttatggatactagaaccggaaacatactaatttgtgcttccacaccg
ggttttgaatcaaataatttcagtaagttatcggaaaattattggcaaagtttaatgagc
gatccttataagcctttaattaataaggtaatacaaagctcgtatcccccaggttcggtt
tttaaaataattaccgtacttgcagcccttgaagtaggcattaatcctaataaaaccgtt
ttttgcgacggtagctctgctcttggtactaatagctttagatgttggaatcatagcggg
catgggacggtagatatgatgtctgctttaaagtattcttgtaatatttatatgtatgaa
ctcgcaaaaatagtaggtccggataaaattcttgaagttgcaagagaatttggtctcggc
tcaaagaccggtattgatttagctcctgaaagtagtggatttgtaccgtcaaaagagtgg
aaaaagaaaaaattacagcttccttggtcaataggtgatagctttaatttagcaataggg
caaggatttttaggagtaacgccgatgcagcttgcaagatttattacagctattgcaagt
aacggtaaactatatacgcctagaatattaaaaaatgattcggaattttataatgttaat
attaagcctgaaaatattaaaataatacaagaaagtttatataatactgtgaatgttgcg
ggaggtacggcgtattataatagaattttaggtaaaaataggcagcttgccggtaaaact
ggtacgtcccaagtacaaggcaaactaaatgctaaagacgatttaaaccgtgactctatt
gcctgggagaggcgtaatcatgctttattcttaggcttcgctccttatcacgatcctcgt
tattccgttactgtttttgttgaccatggaggaggcggtagtaaagcagccgccccaata
gctcgtaaaatcatgtctgacgtgctggataagtatactcgctga

DBGET integrated database retrieval system