KEGG   Rickettsia australis: MC5_07210Help
Entry
MC5_07210         CDS       T01783                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rau  Rickettsia australis
Pathway
rau00020  Citrate cycle (TCA cycle)
rau00190  Oxidative phosphorylation
rau00650  Butanoate metabolism
rau01100  Metabolic pathways
rau01110  Biosynthesis of secondary metabolites
rau01120  Microbial metabolism in diverse environments
rau01130  Biosynthesis of antibiotics
rau01200  Carbon metabolism
Module
rau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rau_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MC5_07210 (sdhA)
   00650 Butanoate metabolism
    MC5_07210 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MC5_07210 (sdhA)
Enzymes [BR:rau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MC5_07210 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     MC5_07210 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AFC71672
UniProt: H8K8S9
LinkDB All DBs
Position
complement(1279627..1281417)
Genome map
AA seq 596 aa AA seqDB search
MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFPTRSHTVAAQGGISAA
LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDVILELEHYGVPFSRTKEGKIYQ
RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLMEEGE
CRGVVAWNLDDGRLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQDM
EFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTIE
IREGRGVGKYKDHVFLHLNHLSPEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYHGQVIIKDAKKHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSAL
KAAELIKPASPHKPLKEDSLEKIINRFDKIRYNNGNILTADLRLKMQRTMQSHASVFRTQ
EVLDEGAGMISEIRSGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKESR
GAHAREDYPDRNDGDWMQHTLSSIDEAGKVVLDYKPVTLTTLTDEISAISPAKRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagcgtataatatcatacatcataaatttgacgtagtagttgtaggtgcaggc
ggagctggtcttcgttctgcatttggtatggctaaagaagggttaaacaccgcctgtata
actaagctatttccgactcgtagtcatactgtggctgctcagggcggaattagtgcagct
cttgggaatatgggcgaagatgattggcgttggcatatgtatgatacagtgaaaggttca
gactggttaggtgatcaggatgccatcgagtatatgtgcaagaatgctccagatgtgatt
ttagagcttgagcattacggagtacctttttcaagaactaaagagggaaaaatttatcag
cgtccttttggcggtatgacaacagagtacggtaaaggaaaagcggctcagcgtacatgt
gctgcggcagatcgtacgggccatgccatacttcatacgttatatcagcagtcactaaag
cataaagtacagttttttgttgagtattttgctattgatttattgatggaagaaggcgaa
tgtagaggcgtagttgcttggaatttagatgatggaagattgcattgttttagagctcat
aatgtagtgcttgcaacgggaggatacgggcgtgcttatttttcagcaacgtctgctcat
acttgtacgggcgacgggggcggtatggcgattagagcaggtttgccgctgcaagatatg
gagtttgtacagttccatccgacaggcatatattcagcgggctgtcttattactgaggga
gctagaggtgaagggggatatctcgttaatgcaaatggagagcgttttatggagcgttat
gctcctgctgcaaaggatttagcttcaagagacgtggtttcaagagcgatgactatcgag
attcgtgaagggcgaggagttggcaagtataaagatcatgtattcctgcatttaaatcat
ttatcgcctgagattttacatagccgtttgccaggtatttctgagacggctaaaattttt
gccggtgttgatgtcactaaagagccgataccggtacttcctacagtgcattataatatg
ggtgggatacctactaattaccatggtcaagtcataatcaaagacgctaaaaagcacaat
agcgtagtaaaaggacttatggcaatcggtgaagcagcttgtgtatcggtacacggtgct
aataggcttggttcaaattctttgcttgatttagtggtatttggtagaagttctgcatta
aaagcagctgaacttattaaaccggcaagtccccataagccgttaaaagaagacagtctt
gaaaaaattataaatagatttgataaaattcgttataataacggtaatattttaactgca
gatttaaggcttaaaatgcaaagaactatgcaaagccacgcttcggtatttagaactcaa
gaggtactagacgaaggagcaggcatgattagtgagataagaagtggctataaagatata
aaaattaacgataaatctttaatttggaatagtgatttagtagaagctttagagctagat
aatctacttgatcaagctttggttacggtatattcggcagctgcaaggaaagagagcaga
ggagctcatgctagggaagattatcctgatcgtaatgatggagattggatgcaacatact
cttagctctatcgatgaagcaggtaaagtagttcttgattataaacctgtaacgctaact
actttaaccgatgagataagtgcaatttcaccagcaaaaagagtgtattaa

DBGET integrated database retrieval system