KEGG   Rhodococcus aetherivorans: AAT18_04880Help
Entry
AAT18_04880       CDS       T03876                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rav  Rhodococcus aetherivorans
Brite
KEGG Orthology (KO) [BR:rav00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AAT18_04880
Enzymes [BR:rav01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AAT18_04880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored AlaDh_PNT_C HI0933_like FAD_binding_3 NAD_binding_7 DAO K_oxygenase Glutaredoxin Thi4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AKE88667
LinkDB All DBs
Position
complement(1060261..1061850)
Genome map
AA seq 529 aa AA seqDB search
MLEASLAGQLKSLLERLTLPIELVSSLDDGPKSAELAELLTEIAAMSDKVTYERRDDDAR
RPSFAVRRVGTDIEVRFAGIPLGHEFTSLALALLQVGGYPSKEPEELQQQVRDLDGELHF
ETYFSLSCQNCPDVVQALNLMCVLNPRIKHVAIDGALFQDEVDGRQVMAVPTVYLNGELF
DSGRMSLEQIIGKLDTGAADRAAAAIDEKDPFDVLVVGGGPAGAAAAIYAARKGIRTGVV
AERFGGQVLDTMAIENFVSVPYTEGPKLGAALDNHVRQYDVDIMNVQRAAKLVPATEGGL
VEVELESGASLLARSVILSTGARWRSMNVPGETEYRNKGVTYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGVVAHVTLLEFDSALRADEVLQRKLRSLPNVDIVVSALTTEVLGDGH
KVTGLTYQDRTTETAHTLELEGIFVQIGLLPNTEWLTGTIELSPRGEIVVDDRGQTSVPG
VFAAGDCTTVPYKQIIIAAGAGATAALGAFDHLIRTSAPAEDSVAAVVR
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagcctcgcttgccggccaactgaagtccctcctcgagcggctgaccctgccg
atcgagctcgtgtcctccctcgacgacggacccaagtccgccgaactcgccgaactgctc
accgagatcgcggcgatgtcggacaaggtcacctacgagcgtcgcgacgacgacgcgcgt
cgcccgtccttcgcggtgcgccgcgtcggcaccgacatcgaggtccgcttcgccggcatc
ccgctgggccacgagttcacctcgctcgcgcttgcactgctccaggtcggcggttacccg
tcgaaggagcccgaggagctgcagcagcaggtgcgagacctggacggcgagctgcacttc
gagacctacttctcgttgtcctgccagaactgtcccgacgtcgtgcaggccctgaacctg
atgtgcgtgctcaacccgcgcatcaagcacgtcgcgatcgacggcgccctgttccaggac
gaggtcgacggacgtcaggtgatggccgtgccgacggtgtacctcaatggcgagctgttc
gactcgggccgcatgagcctcgagcagatcatcggcaagctcgacaccggcgccgcggac
cgggcggcggccgcgatcgacgagaaggacccgttcgacgtgctcgtcgtcggcggcggc
ccggccggtgccgcggccgcgatctacgccgcccgcaagggtattcgcaccggtgtcgtc
gccgagcgcttcggcggccaggtgctcgacacgatggcgatcgagaatttcgtctccgtg
ccctacaccgaaggccccaagctcggcgccgcactcgacaaccacgtccgccagtacgac
gtcgacatcatgaacgtgcagcgcgcggcgaagctcgtgcctgcgaccgagggcggcctc
gtcgaggtcgagctcgagagcggcgcctccctgctcgcccgcagcgtgatcctgtccacg
ggtgcacggtggcgttcgatgaacgtgcccggcgagaccgagtaccggaacaagggcgtg
acctactgcccgcactgcgacggaccgctgttcaagggcaagcgcgtcgccgtgatcggc
ggcggcaactccggcgtcgaggccgcgatcgatctcgccggcgtcgtcgcgcacgtcacg
ctcctcgagttcgactcggcgctgcgcgccgacgaggtgctgcagcgcaagctgcgcagc
ctgccgaacgtcgacatcgtcgtcagcgcgctgaccaccgaggtcctcggcgacggccac
aaggtcaccggcctgacctatcaggaccgcaccaccgagaccgcgcacacgctcgaactg
gagggcatcttcgtccagatcggcctgctgcccaacaccgagtggctcaccgggacgatc
gagctgtcgccgcgcggcgagatcgtcgtcgacgaccgcggccagacctcggtgcccggc
gtgttcgccgccggcgactgcaccacggtgccgtacaagcagatcatcatcgccgccggc
gccggagcgacggcagcgctcggcgcgttcgaccatctcatccgcaccagcgccccggcc
gaggactcggtcgccgcggtcgtccgatag

DBGET integrated database retrieval system