KEGG   Rhodococcus aetherivorans: AAT18_06535Help
Entry
AAT18_06535       CDS       T03876                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rav  Rhodococcus aetherivorans
Brite
KEGG Orthology (KO) [BR:rav00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AAT18_06535
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rav03400]
    AAT18_06535
Enzymes [BR:rav01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AAT18_06535
DNA repair and recombination proteins [BR:rav03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AAT18_06535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AKE88952
LinkDB All DBs
Position
1403527..1405788
Genome map
AA seq 753 aa AA seqDB search
MTTRTFEGRRLNLTNLDKVLYPSTGTTKADVVDYYVAVAPVLLPHVAGRPGTRKRWPEGV
GGESFFEKNLASHAPKWLTRKTVHHKQRSVTYPVFDSVASLAWLGQQAALELHVPQWRFS
GSVPGPATRIVFDLDPGEGVTLAQCAEVARLVRDMVGGLGWPAYPVTSGSKGIHLYVPLD
RELAPGGASTVAKQVAINLETLHPDLVTATMAKAVRGGRVFLDWSQNNQAKTTIAPYSLR
GREQPWVAAPRTWDELDDPGLHQLRFDEVLARLETGPDPLAALDPPLPESDALTEYRHKR
DPSRTPEPVPATVGSGPGNSFVIQEHHARRLHYDLRLERDGVLASWAVPKNLPDDPGRNN
LAVRTEDHPLEYLTFHGVIPKGEYGAGGMTIWDTGTYDTEKWRDDEVIVRLHGARVQGRY
ALIRTAGNQWLAHRMKDQSAPSGPPTSFPRDLEPMLATPGEVTGLDADEWAFEGKWDGYR
AVAEIENGQLRLHSRSGRDITGDYPALADLTRILDGHEVVLDGEVVACDTLGVTSFRQLR
TGGTPQYFVFDVLFLDGVTLYRKPYSDRRRVLDALAAAADGLVVPELLHGNGSEALEEST
RRGWEGVVAKRRNSVYMPGRRSPDWVKSKNWLTQDVVIGGWRLGKGARAGTFGSLLVGVQ
GEAGLEYVGRVGTGFDEPQLAELSAAMAGLRRRTTPFAGDVPREDARDAVWVSPKLVGEV
RFREWTDAGKLWHPSWRGLRDDIDPQDVARGSG
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccgcacgttcgaaggccgtcgtctgaacctgacgaacctcgacaaggtgctg
tacccgagcacgggcacgacgaaggccgacgtggtcgactactacgtcgccgtcgccccg
gtgctgctgccgcacgtcgcgggccggcccggcacccgcaaacgctggcccgagggtgtc
ggcggcgagtcgttcttcgagaagaacctcgcctcccacgcgccgaagtggctcacccgc
aagactgttcaccacaagcagcggtcggtgacgtatccggtcttcgactccgtggcgtcg
ctggcctggctggggcagcaggcggcactcgagctgcacgtgccgcagtggcggttctcg
gggtccgtcccgggtcccgcgacgcggatcgtgttcgacctcgacccgggggagggggtc
acgctggcgcagtgcgccgaggttgcccgcctggtgcgcgacatggtcggcgggctgggc
tggccggcctacccggtcaccagcggcagcaaggggatacacctgtatgtgccgctcgac
cgcgagctcgcgccgggcggggcgtcgaccgtggcgaagcaggtggcgatcaacctcgag
acgctgcatcccgacctggtcaccgccaccatggccaaggccgtgcgcggtggccgggtg
ttcctcgactggagccagaacaaccaggccaagacgaccatcgcgccgtattccctgcgc
ggccgggagcagccgtgggtcgccgcgccccgcacctgggacgaactcgacgaccccggg
ttgcaccaattgcggttcgacgaggtgctcgcgcgcctcgagaccggacccgacccgctc
gccgcgctcgacccgccgctgcccgagtccgacgccctgaccgagtaccggcacaagcgc
gacccgtcccgcacccccgaacccgtccccgccaccgtgggatccggaccgggcaattcc
ttcgtcatccaggagcaccacgcccgccgcctgcactacgacctgaggctcgagcgcgac
ggggtgctcgcgtcgtgggcggtgccgaagaatctgccggacgatcccggccgcaacaac
ctcgcggtgcgcaccgaggaccatccgctcgagtacctcaccttccacggcgtgatcccc
aagggggagtacggcgccggcggcatgacgatctgggacaccggcacctacgacaccgag
aaatggcgcgacgacgaggtgatcgtgcgcctgcacggcgcgcgggtgcagggccggtac
gcgctgatccgcacggccggcaaccagtggctcgcgcaccgcatgaaggaccagagcgcg
ccgtcgggcccgccgacgagcttcccgcgcgacctcgagcccatgctcgcgacaccgggt
gaggtgaccggtctcgacgccgacgaatgggcgttcgagggcaagtgggacggctaccgc
gccgtcgccgagatcgagaacgggcagctgcggctgcattcgcgttccggccgcgacatc
accggcgactaccccgctctcgccgatctcacccgcatcctcgacgggcacgaggtggtc
ctcgacggcgaggtggtcgcgtgcgacaccctcggtgtcacaagcttccggcagctgcgg
accgggggcaccccgcagtacttcgtgttcgacgtcctcttcctcgacggggtgaccctg
taccgcaagccgtattccgaccggcggcgcgtgctcgacgcgctcgccgccgcggccgac
gggctggttgttccggaactgttgcacggcaacggatccgaagcgctggaggagagcacc
cggcggggctgggaaggggtggtggccaagcggcggaactcggtgtacatgccgggccgg
cgcagccccgactgggtgaagtcgaagaactggctcacccaggacgtcgtcatcgggggc
tggcgcctcggcaagggggcccgcgccggcaccttcggctcgctgctggtcggcgtgcag
ggcgaggccgggctggagtacgtcggccgcgtcggcaccggcttcgacgaaccccagctc
gccgaactgtcggccgccatggcgggtctgcggcgccgcaccacgcccttcgccggcgac
gtcccgcgcgaggacgcgcgggacgcggtgtgggtgagcccgaagctggtgggggaggtg
cggttccgggagtggaccgacgccggcaagctctggcatccgagctggcgcgggttgcgc
gacgacatcgacccgcaggacgtggcccgcggcagcggatga

DBGET integrated database retrieval system